Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2GZV5

Protein Details
Accession I2GZV5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-47SNSADSKVKKVRKPRSKKVNKLSQDQVRHydrophilic
NLS Segment(s)
PositionSequence
26-38KVKKVRKPRSKKV
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
KEGG tbl:TBLA_0B08420  -  
PROSITE View protein in PROSITE  
PS50888  BHLH  
Amino Acid Sequences MDTTDSQSSFIDSPVPNSLSNSADSKVKKVRKPRSKKVNKLSQDQVRINHVDSEKRRRDLVRGIYDKLVETVPDLTPDEGRSEIAIYCKTINYLEWLYYRNKSLRIQLSEKIRLSTDPEVKKIKIDESLTWDINEAALNISHKLEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.23
4 0.24
5 0.26
6 0.22
7 0.24
8 0.23
9 0.19
10 0.23
11 0.24
12 0.28
13 0.35
14 0.41
15 0.46
16 0.54
17 0.64
18 0.69
19 0.78
20 0.83
21 0.85
22 0.88
23 0.92
24 0.92
25 0.92
26 0.86
27 0.83
28 0.82
29 0.78
30 0.75
31 0.68
32 0.6
33 0.54
34 0.49
35 0.43
36 0.39
37 0.32
38 0.31
39 0.34
40 0.42
41 0.43
42 0.43
43 0.45
44 0.41
45 0.44
46 0.45
47 0.48
48 0.47
49 0.44
50 0.44
51 0.42
52 0.41
53 0.37
54 0.3
55 0.21
56 0.11
57 0.09
58 0.09
59 0.08
60 0.09
61 0.09
62 0.08
63 0.09
64 0.09
65 0.1
66 0.08
67 0.08
68 0.07
69 0.08
70 0.08
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.1
77 0.09
78 0.09
79 0.12
80 0.12
81 0.13
82 0.14
83 0.16
84 0.18
85 0.2
86 0.23
87 0.22
88 0.25
89 0.25
90 0.32
91 0.37
92 0.41
93 0.43
94 0.45
95 0.5
96 0.54
97 0.52
98 0.46
99 0.39
100 0.34
101 0.35
102 0.38
103 0.39
104 0.35
105 0.4
106 0.43
107 0.43
108 0.45
109 0.42
110 0.37
111 0.35
112 0.35
113 0.33
114 0.36
115 0.41
116 0.39
117 0.36
118 0.34
119 0.27
120 0.24
121 0.21
122 0.14
123 0.09
124 0.1
125 0.11
126 0.12