Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166AG81

Protein Details
Accession A0A166AG81   
Localization Confidence High
Confidence Score 19.3
NoLS Segment(s)
PositionSequenceProtein Nature
194-225TQKPDKPYKHRDGVKKPRKPKKQDEWDNDNADBasic
269-290RGRGRGGKKVSNKARTRRTSASBasic
NLS Segment(s)
PositionSequence
162-170RRPPPKGKK
199-215KPYKHRDGVKKPRKPKK
248-286KKEKPSTQRGGKSGRGGADRGRGRGRGGKKVSNKARTRR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MDNSLGLDVTGAVDVPSPDPPPADAQPASPPPATPASATSKPQQQQQPQGEKKVPYVNKNRVQTGGAPREKLSPEELEAKMAEIRKRNQLIKEKRELVLADEAAFKQQLAEDEAGRKARDDNTRKVQAKVNQERGQNAQRKLEKMGGREWDSAKGDDWSQARRPPPKGKKPTEELEPSPSDGNWKAAQQEQEGTQKPDKPYKHRDGVKKPRKPKKQDEWDNDNADKPEGEDAIERSESSASEDEWGQKKEKPSTQRGGKSGRGGADRGRGRGRGGKKVSNKARTRRTSASTDEDEGPTEPIAVMMPKTPPGGFKPLEVDVAQTNWAGDVIDESGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.11
4 0.12
5 0.13
6 0.14
7 0.15
8 0.2
9 0.21
10 0.26
11 0.24
12 0.25
13 0.32
14 0.35
15 0.37
16 0.32
17 0.3
18 0.28
19 0.31
20 0.3
21 0.23
22 0.24
23 0.28
24 0.32
25 0.35
26 0.36
27 0.41
28 0.43
29 0.5
30 0.55
31 0.55
32 0.6
33 0.67
34 0.73
35 0.7
36 0.75
37 0.73
38 0.66
39 0.63
40 0.63
41 0.58
42 0.57
43 0.61
44 0.63
45 0.66
46 0.69
47 0.67
48 0.59
49 0.56
50 0.53
51 0.53
52 0.53
53 0.49
54 0.45
55 0.44
56 0.47
57 0.46
58 0.4
59 0.34
60 0.26
61 0.25
62 0.3
63 0.29
64 0.25
65 0.24
66 0.23
67 0.23
68 0.25
69 0.26
70 0.26
71 0.29
72 0.36
73 0.42
74 0.46
75 0.51
76 0.58
77 0.64
78 0.66
79 0.72
80 0.67
81 0.62
82 0.6
83 0.52
84 0.44
85 0.39
86 0.31
87 0.22
88 0.2
89 0.19
90 0.17
91 0.17
92 0.13
93 0.08
94 0.09
95 0.09
96 0.1
97 0.11
98 0.12
99 0.14
100 0.17
101 0.19
102 0.18
103 0.17
104 0.16
105 0.22
106 0.3
107 0.34
108 0.4
109 0.46
110 0.56
111 0.57
112 0.58
113 0.58
114 0.55
115 0.59
116 0.6
117 0.61
118 0.57
119 0.57
120 0.56
121 0.55
122 0.57
123 0.54
124 0.47
125 0.45
126 0.43
127 0.43
128 0.43
129 0.45
130 0.39
131 0.34
132 0.36
133 0.34
134 0.34
135 0.35
136 0.34
137 0.31
138 0.3
139 0.28
140 0.24
141 0.2
142 0.16
143 0.17
144 0.18
145 0.17
146 0.18
147 0.22
148 0.26
149 0.31
150 0.37
151 0.44
152 0.53
153 0.6
154 0.67
155 0.7
156 0.71
157 0.7
158 0.68
159 0.64
160 0.59
161 0.5
162 0.45
163 0.39
164 0.34
165 0.29
166 0.25
167 0.21
168 0.17
169 0.18
170 0.14
171 0.13
172 0.14
173 0.16
174 0.18
175 0.16
176 0.17
177 0.17
178 0.23
179 0.24
180 0.27
181 0.27
182 0.3
183 0.32
184 0.38
185 0.4
186 0.42
187 0.49
188 0.53
189 0.59
190 0.62
191 0.69
192 0.73
193 0.79
194 0.82
195 0.81
196 0.84
197 0.85
198 0.88
199 0.88
200 0.87
201 0.87
202 0.88
203 0.89
204 0.88
205 0.86
206 0.83
207 0.79
208 0.69
209 0.61
210 0.5
211 0.4
212 0.3
213 0.22
214 0.17
215 0.11
216 0.11
217 0.1
218 0.1
219 0.13
220 0.13
221 0.12
222 0.12
223 0.12
224 0.11
225 0.13
226 0.13
227 0.1
228 0.11
229 0.13
230 0.18
231 0.22
232 0.24
233 0.23
234 0.26
235 0.31
236 0.37
237 0.43
238 0.46
239 0.5
240 0.58
241 0.65
242 0.69
243 0.69
244 0.68
245 0.66
246 0.63
247 0.58
248 0.52
249 0.45
250 0.4
251 0.37
252 0.4
253 0.38
254 0.38
255 0.38
256 0.34
257 0.35
258 0.42
259 0.44
260 0.45
261 0.48
262 0.52
263 0.57
264 0.67
265 0.73
266 0.75
267 0.78
268 0.78
269 0.83
270 0.81
271 0.81
272 0.77
273 0.73
274 0.69
275 0.66
276 0.64
277 0.57
278 0.54
279 0.49
280 0.42
281 0.38
282 0.33
283 0.28
284 0.21
285 0.17
286 0.12
287 0.1
288 0.1
289 0.09
290 0.09
291 0.1
292 0.12
293 0.14
294 0.16
295 0.17
296 0.19
297 0.23
298 0.3
299 0.29
300 0.3
301 0.32
302 0.32
303 0.35
304 0.31
305 0.29
306 0.23
307 0.23
308 0.22
309 0.17
310 0.15
311 0.12
312 0.12
313 0.1
314 0.08
315 0.08