Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165CWA4

Protein Details
Accession A0A165CWA4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
233-252RELRDRERERWDRKRPASPPBasic
NLS Segment(s)
PositionSequence
162-264RERDRKRPNDGPSGGPLKRARPMSPPPGARDRDRDRDRERERERDQREREMRERERERDMIRERDRERDRERELRDRERERWDRKRPASPPYRNGSPARRPDE
326-338PRARSPPAPRGRP
Subcellular Location(s) nucl 11.5, cyto_nucl 10, cyto 7.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045243  Rna14-like  
IPR008847  Suf  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0006378  P:mRNA polyadenylation  
Pfam View protein in Pfam  
PF05843  Suf  
Amino Acid Sequences MEYHCTKATDVATRIFQNGMNLFANELEFVDRYLAFLISINDESNARALFERVAPNFVGPKGRMLWERWGRYEYQYGDLEAVLKFEKRFADAFKEVSSIKRFADRHKYGVLDAIASRDLGVGIRTRVTRSETNATSLLHKTGSGSGNEDRDRRDAHSPDNERERDRKRPNDGPSGGPLKRARPMSPPPGARDRDRDRDRERERERDQREREMRERERERDMIRERDRERDRERELRDRERERWDRKRPASPPYRNGSPARRPDERDRDDGRANKGIPPAVTRFLSTLPAPQSFDGPIFRTDDLMQLFRNAAIPAPSPTGGPPMGPPRARSPPAPRGRPPPDYGPYTGPGGGARRGRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.31
4 0.28
5 0.27
6 0.27
7 0.23
8 0.22
9 0.21
10 0.2
11 0.19
12 0.14
13 0.13
14 0.11
15 0.09
16 0.1
17 0.11
18 0.1
19 0.11
20 0.12
21 0.11
22 0.09
23 0.11
24 0.12
25 0.13
26 0.14
27 0.14
28 0.14
29 0.14
30 0.14
31 0.15
32 0.14
33 0.12
34 0.11
35 0.12
36 0.13
37 0.17
38 0.23
39 0.21
40 0.24
41 0.23
42 0.24
43 0.26
44 0.26
45 0.27
46 0.21
47 0.24
48 0.23
49 0.27
50 0.29
51 0.29
52 0.38
53 0.42
54 0.45
55 0.45
56 0.45
57 0.43
58 0.43
59 0.47
60 0.39
61 0.35
62 0.31
63 0.29
64 0.27
65 0.25
66 0.23
67 0.16
68 0.15
69 0.1
70 0.11
71 0.11
72 0.13
73 0.14
74 0.15
75 0.16
76 0.18
77 0.25
78 0.25
79 0.27
80 0.25
81 0.26
82 0.24
83 0.27
84 0.28
85 0.22
86 0.21
87 0.27
88 0.28
89 0.33
90 0.44
91 0.42
92 0.42
93 0.44
94 0.44
95 0.36
96 0.39
97 0.32
98 0.23
99 0.19
100 0.17
101 0.14
102 0.12
103 0.12
104 0.08
105 0.08
106 0.06
107 0.07
108 0.07
109 0.07
110 0.1
111 0.11
112 0.12
113 0.14
114 0.18
115 0.2
116 0.24
117 0.3
118 0.28
119 0.31
120 0.31
121 0.3
122 0.28
123 0.27
124 0.22
125 0.16
126 0.15
127 0.12
128 0.15
129 0.17
130 0.14
131 0.16
132 0.18
133 0.22
134 0.25
135 0.25
136 0.23
137 0.23
138 0.24
139 0.24
140 0.29
141 0.26
142 0.28
143 0.36
144 0.38
145 0.4
146 0.47
147 0.46
148 0.42
149 0.48
150 0.49
151 0.5
152 0.54
153 0.57
154 0.56
155 0.62
156 0.64
157 0.66
158 0.63
159 0.54
160 0.5
161 0.5
162 0.42
163 0.4
164 0.36
165 0.29
166 0.31
167 0.31
168 0.28
169 0.28
170 0.34
171 0.36
172 0.4
173 0.41
174 0.4
175 0.46
176 0.47
177 0.43
178 0.46
179 0.45
180 0.49
181 0.5
182 0.54
183 0.51
184 0.59
185 0.62
186 0.64
187 0.63
188 0.62
189 0.64
190 0.66
191 0.68
192 0.68
193 0.66
194 0.66
195 0.68
196 0.65
197 0.65
198 0.65
199 0.64
200 0.64
201 0.66
202 0.59
203 0.58
204 0.56
205 0.51
206 0.51
207 0.51
208 0.5
209 0.5
210 0.54
211 0.51
212 0.56
213 0.59
214 0.58
215 0.58
216 0.56
217 0.58
218 0.58
219 0.62
220 0.62
221 0.65
222 0.66
223 0.7
224 0.67
225 0.66
226 0.68
227 0.72
228 0.72
229 0.75
230 0.76
231 0.77
232 0.78
233 0.81
234 0.76
235 0.76
236 0.77
237 0.75
238 0.73
239 0.7
240 0.68
241 0.64
242 0.65
243 0.63
244 0.62
245 0.62
246 0.61
247 0.6
248 0.61
249 0.67
250 0.72
251 0.68
252 0.67
253 0.62
254 0.61
255 0.63
256 0.61
257 0.57
258 0.52
259 0.48
260 0.44
261 0.42
262 0.39
263 0.33
264 0.32
265 0.3
266 0.28
267 0.27
268 0.24
269 0.22
270 0.21
271 0.23
272 0.2
273 0.22
274 0.21
275 0.23
276 0.24
277 0.23
278 0.24
279 0.22
280 0.23
281 0.2
282 0.19
283 0.18
284 0.2
285 0.19
286 0.2
287 0.19
288 0.22
289 0.22
290 0.22
291 0.2
292 0.19
293 0.19
294 0.17
295 0.19
296 0.14
297 0.13
298 0.13
299 0.15
300 0.16
301 0.19
302 0.18
303 0.17
304 0.18
305 0.21
306 0.19
307 0.18
308 0.2
309 0.25
310 0.32
311 0.34
312 0.36
313 0.4
314 0.49
315 0.51
316 0.54
317 0.55
318 0.58
319 0.67
320 0.72
321 0.7
322 0.71
323 0.76
324 0.76
325 0.72
326 0.7
327 0.67
328 0.63
329 0.61
330 0.55
331 0.5
332 0.46
333 0.41
334 0.32
335 0.29
336 0.27
337 0.3