Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165M4D5

Protein Details
Accession A0A165M4D5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-39QATLSSKKEGCRRTRKQRGIVASHRREHydrophilic
NLS Segment(s)
PositionSequence
118-127GKKKHRAKEG
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MTLSCLLWSYGPQATLSSKKEGCRRTRKQRGIVASHRREGQSAWYVCVDEGKSSCHGMYCSECARLSPRLPSPRRRSGSTSQETATGRLQSTVLCVLRVSIDGTGLCEDETGLSCKAGKKKHRAKEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.26
3 0.28
4 0.31
5 0.32
6 0.37
7 0.45
8 0.52
9 0.58
10 0.62
11 0.7
12 0.74
13 0.82
14 0.85
15 0.86
16 0.85
17 0.83
18 0.81
19 0.81
20 0.8
21 0.74
22 0.69
23 0.63
24 0.56
25 0.48
26 0.4
27 0.35
28 0.33
29 0.28
30 0.26
31 0.23
32 0.23
33 0.22
34 0.24
35 0.18
36 0.11
37 0.11
38 0.11
39 0.12
40 0.12
41 0.12
42 0.11
43 0.11
44 0.11
45 0.12
46 0.13
47 0.13
48 0.14
49 0.14
50 0.14
51 0.17
52 0.18
53 0.17
54 0.19
55 0.24
56 0.32
57 0.37
58 0.46
59 0.52
60 0.59
61 0.62
62 0.61
63 0.61
64 0.6
65 0.65
66 0.6
67 0.54
68 0.45
69 0.46
70 0.42
71 0.38
72 0.32
73 0.24
74 0.2
75 0.18
76 0.17
77 0.12
78 0.14
79 0.17
80 0.15
81 0.13
82 0.13
83 0.12
84 0.13
85 0.14
86 0.13
87 0.07
88 0.08
89 0.08
90 0.1
91 0.11
92 0.1
93 0.09
94 0.08
95 0.08
96 0.08
97 0.1
98 0.11
99 0.11
100 0.11
101 0.14
102 0.2
103 0.27
104 0.35
105 0.43
106 0.51
107 0.61