Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165M4G3

Protein Details
Accession A0A165M4G3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-29LYAKGRILGHKRGKRNTRPNTSLVHydrophilic
NLS Segment(s)
PositionSequence
15-19HKRGK
Subcellular Location(s) mito_nucl 11.833, mito 11.5, nucl 11, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MPSTRLYAKGRILGHKRGKRNTRPNTSLVQIEGVSNKDDAQFYLGKRLAYVYKAKTETRGSKVRVIWGRVTRPHGNSGVVKSKFKSNLPPHTFGASIRVMLYPSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.69
4 0.73
5 0.79
6 0.8
7 0.85
8 0.85
9 0.85
10 0.81
11 0.76
12 0.71
13 0.63
14 0.54
15 0.44
16 0.35
17 0.25
18 0.21
19 0.19
20 0.15
21 0.13
22 0.12
23 0.11
24 0.11
25 0.11
26 0.1
27 0.11
28 0.13
29 0.12
30 0.19
31 0.2
32 0.19
33 0.19
34 0.2
35 0.18
36 0.18
37 0.23
38 0.17
39 0.21
40 0.24
41 0.24
42 0.26
43 0.31
44 0.34
45 0.35
46 0.4
47 0.37
48 0.41
49 0.41
50 0.45
51 0.44
52 0.42
53 0.42
54 0.41
55 0.44
56 0.42
57 0.48
58 0.45
59 0.43
60 0.44
61 0.39
62 0.37
63 0.34
64 0.36
65 0.38
66 0.36
67 0.36
68 0.34
69 0.39
70 0.4
71 0.4
72 0.45
73 0.45
74 0.53
75 0.58
76 0.61
77 0.57
78 0.56
79 0.54
80 0.43
81 0.4
82 0.3
83 0.23
84 0.2
85 0.18
86 0.15