Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165DWU1

Protein Details
Accession A0A165DWU1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
353-374SAPTPRRPPGTPRRTPRKTKETBasic
NLS Segment(s)
PositionSequence
358-372RRPPGTPRRTPRKTK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013218  Dsn1/Mis13  
Gene Ontology GO:0000444  C:MIS12/MIND type complex  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
Pfam View protein in Pfam  
PF08202  MIS13  
Amino Acid Sequences MGSGVISQPHPTVPTSSYHKHLPPDLPEALRTRHLLMWCASWAAKQPPSAPSSKPGSSSKPASSSKLPTLSANDAKLAKSIQTEVMNLLAAGKLDTNVISRTDKSAAAAQAANLAPHDQNIKNLKRKNDFMSGIAQAKAEDGAWTDLIQEYKARSSSVMSSLNAQRDQLSRSQDKGKGREISDWEPWDNELDDKWSEAAATARDSLRLNRQRRTSVSGDTNRIRAHSPISARLKSLELKSDKLHETVNTASAMAEQVHVKLDAIFSNLSETLKSRSVQYPASTSAAGPSSSMSKMIPGASEPAAQDPILLLRGISRSDATRPDSQISAPVRRTRQSIATAPPDAGVSRYTAVSAPTPRRPPGTPRRTPRKTKET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.34
4 0.37
5 0.42
6 0.45
7 0.47
8 0.51
9 0.51
10 0.49
11 0.51
12 0.52
13 0.47
14 0.47
15 0.45
16 0.42
17 0.4
18 0.37
19 0.33
20 0.32
21 0.32
22 0.32
23 0.29
24 0.29
25 0.26
26 0.26
27 0.23
28 0.2
29 0.24
30 0.27
31 0.29
32 0.28
33 0.31
34 0.34
35 0.38
36 0.4
37 0.36
38 0.36
39 0.39
40 0.39
41 0.4
42 0.4
43 0.43
44 0.46
45 0.49
46 0.47
47 0.48
48 0.49
49 0.49
50 0.5
51 0.49
52 0.49
53 0.48
54 0.45
55 0.39
56 0.41
57 0.43
58 0.41
59 0.37
60 0.34
61 0.31
62 0.3
63 0.29
64 0.25
65 0.19
66 0.17
67 0.17
68 0.18
69 0.19
70 0.19
71 0.18
72 0.18
73 0.16
74 0.14
75 0.13
76 0.09
77 0.07
78 0.07
79 0.06
80 0.05
81 0.06
82 0.07
83 0.08
84 0.09
85 0.11
86 0.13
87 0.14
88 0.17
89 0.18
90 0.18
91 0.18
92 0.21
93 0.19
94 0.2
95 0.19
96 0.16
97 0.19
98 0.19
99 0.17
100 0.13
101 0.14
102 0.11
103 0.12
104 0.17
105 0.12
106 0.19
107 0.27
108 0.34
109 0.41
110 0.46
111 0.53
112 0.55
113 0.59
114 0.58
115 0.57
116 0.51
117 0.45
118 0.44
119 0.4
120 0.35
121 0.31
122 0.26
123 0.18
124 0.16
125 0.15
126 0.1
127 0.07
128 0.06
129 0.07
130 0.07
131 0.07
132 0.07
133 0.08
134 0.08
135 0.08
136 0.09
137 0.08
138 0.1
139 0.11
140 0.11
141 0.1
142 0.11
143 0.13
144 0.16
145 0.18
146 0.16
147 0.2
148 0.23
149 0.26
150 0.24
151 0.23
152 0.2
153 0.19
154 0.21
155 0.2
156 0.23
157 0.22
158 0.24
159 0.3
160 0.33
161 0.37
162 0.39
163 0.41
164 0.4
165 0.4
166 0.41
167 0.4
168 0.39
169 0.38
170 0.36
171 0.3
172 0.25
173 0.24
174 0.21
175 0.16
176 0.12
177 0.08
178 0.09
179 0.08
180 0.08
181 0.08
182 0.07
183 0.07
184 0.07
185 0.08
186 0.06
187 0.07
188 0.08
189 0.08
190 0.1
191 0.11
192 0.13
193 0.22
194 0.3
195 0.33
196 0.38
197 0.42
198 0.45
199 0.47
200 0.51
201 0.44
202 0.41
203 0.45
204 0.44
205 0.46
206 0.43
207 0.44
208 0.38
209 0.36
210 0.32
211 0.24
212 0.22
213 0.2
214 0.21
215 0.26
216 0.32
217 0.31
218 0.31
219 0.31
220 0.31
221 0.3
222 0.3
223 0.29
224 0.25
225 0.27
226 0.28
227 0.31
228 0.31
229 0.28
230 0.28
231 0.21
232 0.22
233 0.2
234 0.2
235 0.15
236 0.14
237 0.12
238 0.11
239 0.12
240 0.08
241 0.09
242 0.07
243 0.07
244 0.08
245 0.08
246 0.08
247 0.08
248 0.09
249 0.08
250 0.1
251 0.09
252 0.08
253 0.1
254 0.11
255 0.11
256 0.1
257 0.11
258 0.13
259 0.16
260 0.17
261 0.19
262 0.22
263 0.25
264 0.28
265 0.29
266 0.29
267 0.28
268 0.3
269 0.26
270 0.22
271 0.21
272 0.19
273 0.17
274 0.14
275 0.12
276 0.12
277 0.12
278 0.13
279 0.11
280 0.11
281 0.12
282 0.13
283 0.12
284 0.1
285 0.13
286 0.14
287 0.16
288 0.15
289 0.16
290 0.17
291 0.16
292 0.15
293 0.12
294 0.12
295 0.11
296 0.1
297 0.08
298 0.09
299 0.11
300 0.11
301 0.12
302 0.13
303 0.14
304 0.18
305 0.23
306 0.26
307 0.3
308 0.33
309 0.34
310 0.34
311 0.32
312 0.37
313 0.37
314 0.4
315 0.4
316 0.44
317 0.46
318 0.48
319 0.52
320 0.49
321 0.5
322 0.49
323 0.49
324 0.49
325 0.51
326 0.49
327 0.45
328 0.41
329 0.36
330 0.29
331 0.24
332 0.17
333 0.13
334 0.13
335 0.12
336 0.13
337 0.13
338 0.14
339 0.19
340 0.26
341 0.31
342 0.39
343 0.45
344 0.48
345 0.52
346 0.54
347 0.59
348 0.62
349 0.66
350 0.67
351 0.72
352 0.8
353 0.85
354 0.91