Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2H8Q9

Protein Details
Accession I2H8Q9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-32ASSLPHPKIVKKHTKKFKRHHSDRYHRVAENBasic
NLS Segment(s)
PositionSequence
9-37KIVKKHTKKFKRHHSDRYHRVAENWRKQK
Subcellular Location(s) mito_nucl 12, nucl 11.5, mito 11.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tbl:TBLA_0I01020  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MASSLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNISEPKIGYGSNKKTKFMSPSGHKVFLVANVKDLETLTMHTKSYAAEIAHNVSAKNRIVILSKAKTLGIKVTNAKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.85
3 0.9
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.9
13 0.85
14 0.74
15 0.69
16 0.69
17 0.68
18 0.68
19 0.67
20 0.6
21 0.55
22 0.54
23 0.56
24 0.52
25 0.49
26 0.46
27 0.46
28 0.53
29 0.62
30 0.66
31 0.6
32 0.55
33 0.51
34 0.47
35 0.46
36 0.44
37 0.45
38 0.47
39 0.51
40 0.49
41 0.46
42 0.43
43 0.35
44 0.31
45 0.28
46 0.3
47 0.35
48 0.36
49 0.36
50 0.37
51 0.39
52 0.41
53 0.37
54 0.37
55 0.33
56 0.41
57 0.44
58 0.44
59 0.41
60 0.37
61 0.33
62 0.31
63 0.31
64 0.22
65 0.2
66 0.19
67 0.2
68 0.19
69 0.19
70 0.13
71 0.08
72 0.1
73 0.11
74 0.12
75 0.12
76 0.12
77 0.12
78 0.12
79 0.13
80 0.14
81 0.11
82 0.12
83 0.13
84 0.16
85 0.17
86 0.18
87 0.16
88 0.15
89 0.19
90 0.18
91 0.18
92 0.16
93 0.15
94 0.17
95 0.22
96 0.28
97 0.27
98 0.29
99 0.29
100 0.29
101 0.29
102 0.28
103 0.31
104 0.26
105 0.28
106 0.31
107 0.38
108 0.43
109 0.43
110 0.43
111 0.39