Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2H6P4

Protein Details
Accession I2H6P4    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-38LEKVNRKNRKDDTKKSAKPKKYSBasic
NLS Segment(s)
PositionSequence
21-36RKNRKDDTKKSAKPKK
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024645  Mitochondr_Som1  
Gene Ontology GO:0042720  C:mitochondrial inner membrane peptidase complex  
KEGG tbl:TBLA_0G00990  -  
Pfam View protein in Pfam  
PF11093  Mitochondr_Som1  
Amino Acid Sequences MAPPVTIQTKEELDILEKVNRKNRKDDTKKSAKPKKYSITQYECFDNDKGQIECFPFKRIFQQVGEYRREITDETTNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.22
4 0.25
5 0.28
6 0.36
7 0.43
8 0.44
9 0.5
10 0.57
11 0.62
12 0.68
13 0.73
14 0.75
15 0.78
16 0.83
17 0.85
18 0.85
19 0.82
20 0.78
21 0.77
22 0.74
23 0.71
24 0.71
25 0.68
26 0.66
27 0.62
28 0.57
29 0.52
30 0.45
31 0.39
32 0.32
33 0.25
34 0.19
35 0.19
36 0.18
37 0.16
38 0.17
39 0.18
40 0.22
41 0.23
42 0.25
43 0.23
44 0.23
45 0.3
46 0.32
47 0.33
48 0.3
49 0.38
50 0.42
51 0.47
52 0.5
53 0.45
54 0.41
55 0.38
56 0.38
57 0.3
58 0.27