Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H420

Protein Details
Accession I2H420    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-49PLLTHFERWSRKKKKLLLPTKDFNIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5mito_nucl 12.5, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031415  Rrg8  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0000002  P:mitochondrial genome maintenance  
KEGG tbl:TBLA_0E00610  -  
Pfam View protein in Pfam  
PF17068  RRG8  
Amino Acid Sequences MRITQSFKKNISNPFKFKDSVRLSPLLTHFERWSRKKKKLLLPTKDFNIDDNDKRLVKPSLPNFDLQNNPIANLLSSPIRRDRISKAHLPKELLMQAKYLPVDMSMNKLQLVFPIFQNKKGRNSYLANSEAVLLKQIKGKYQWVPPSIIHSSVRKYNLSDISIEKDAIEIYKNKLVSFIEQKLVIASKKDYKRNILKPFRVTFKTEISPSIMIRREQDPLTSKLIQINLDPLKYLWVEKLQLENDELILNIQDDYELIYSLFKLIYFTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.69
3 0.63
4 0.59
5 0.59
6 0.56
7 0.53
8 0.51
9 0.49
10 0.45
11 0.49
12 0.49
13 0.46
14 0.4
15 0.36
16 0.34
17 0.39
18 0.47
19 0.49
20 0.57
21 0.6
22 0.67
23 0.73
24 0.8
25 0.81
26 0.83
27 0.86
28 0.86
29 0.85
30 0.83
31 0.79
32 0.75
33 0.65
34 0.56
35 0.53
36 0.48
37 0.43
38 0.39
39 0.39
40 0.34
41 0.34
42 0.37
43 0.32
44 0.3
45 0.35
46 0.39
47 0.43
48 0.43
49 0.45
50 0.43
51 0.45
52 0.44
53 0.37
54 0.36
55 0.26
56 0.25
57 0.24
58 0.22
59 0.17
60 0.13
61 0.14
62 0.12
63 0.13
64 0.15
65 0.19
66 0.23
67 0.23
68 0.27
69 0.32
70 0.36
71 0.41
72 0.47
73 0.51
74 0.55
75 0.57
76 0.56
77 0.51
78 0.47
79 0.46
80 0.4
81 0.31
82 0.25
83 0.22
84 0.22
85 0.21
86 0.16
87 0.11
88 0.09
89 0.11
90 0.1
91 0.14
92 0.13
93 0.14
94 0.14
95 0.14
96 0.13
97 0.13
98 0.15
99 0.11
100 0.11
101 0.21
102 0.21
103 0.27
104 0.34
105 0.35
106 0.4
107 0.43
108 0.43
109 0.38
110 0.41
111 0.38
112 0.37
113 0.36
114 0.28
115 0.25
116 0.24
117 0.19
118 0.16
119 0.15
120 0.09
121 0.09
122 0.12
123 0.12
124 0.14
125 0.15
126 0.19
127 0.21
128 0.27
129 0.32
130 0.3
131 0.32
132 0.31
133 0.34
134 0.32
135 0.3
136 0.26
137 0.22
138 0.23
139 0.25
140 0.27
141 0.22
142 0.22
143 0.25
144 0.26
145 0.25
146 0.25
147 0.21
148 0.23
149 0.22
150 0.21
151 0.16
152 0.13
153 0.12
154 0.1
155 0.11
156 0.09
157 0.11
158 0.15
159 0.15
160 0.15
161 0.17
162 0.17
163 0.19
164 0.24
165 0.24
166 0.22
167 0.22
168 0.22
169 0.21
170 0.23
171 0.19
172 0.15
173 0.15
174 0.22
175 0.29
176 0.36
177 0.39
178 0.45
179 0.55
180 0.62
181 0.7
182 0.71
183 0.71
184 0.73
185 0.74
186 0.72
187 0.66
188 0.61
189 0.54
190 0.5
191 0.47
192 0.4
193 0.37
194 0.33
195 0.32
196 0.28
197 0.32
198 0.29
199 0.26
200 0.28
201 0.29
202 0.28
203 0.27
204 0.31
205 0.29
206 0.3
207 0.34
208 0.33
209 0.31
210 0.32
211 0.33
212 0.29
213 0.25
214 0.3
215 0.26
216 0.25
217 0.25
218 0.21
219 0.22
220 0.21
221 0.22
222 0.17
223 0.18
224 0.2
225 0.21
226 0.28
227 0.26
228 0.27
229 0.28
230 0.25
231 0.22
232 0.2
233 0.18
234 0.12
235 0.11
236 0.09
237 0.08
238 0.07
239 0.06
240 0.06
241 0.08
242 0.08
243 0.08
244 0.08
245 0.08
246 0.08
247 0.1
248 0.1
249 0.08
250 0.08