Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165ZGH6

Protein Details
Accession A0A165ZGH6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPSRRKRPEPIGRRRLPRLPPRPLVBasic
33-52QAWCRSPSRRPLPSPPSRTPHydrophilic
NLS Segment(s)
PositionSequence
4-22RRKRPEPIGRRRLPRLPPR
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MPSRRKRPEPIGRRRLPRLPPRPLVGSDASRTQAWCRSPSRRPLPSPPSRTPTAPIPASQCRQPINRLPGKVRGSNRRKPTGLTAPTMDGDEQAQVPPPEPPTETAETAPAAEAEPPAASETGTTAPAPGTAATPAPAPSPAQKVNHNVHYPPPGLAQQGMHMAPPPYATIPGVQYYMPYYTYPPGAPGQAMPGYPHPIAFVQPKTSPGSPSAGTSAQAPPSPEDKPKKSLVIACYSCKGATRNAPRHLVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.84
4 0.84
5 0.82
6 0.81
7 0.78
8 0.75
9 0.72
10 0.65
11 0.61
12 0.55
13 0.49
14 0.42
15 0.39
16 0.36
17 0.32
18 0.31
19 0.29
20 0.3
21 0.29
22 0.32
23 0.36
24 0.42
25 0.49
26 0.58
27 0.65
28 0.67
29 0.7
30 0.74
31 0.77
32 0.79
33 0.8
34 0.77
35 0.73
36 0.68
37 0.63
38 0.56
39 0.52
40 0.49
41 0.42
42 0.37
43 0.38
44 0.41
45 0.42
46 0.42
47 0.39
48 0.37
49 0.38
50 0.42
51 0.44
52 0.47
53 0.5
54 0.51
55 0.5
56 0.55
57 0.56
58 0.57
59 0.56
60 0.57
61 0.6
62 0.64
63 0.69
64 0.67
65 0.64
66 0.59
67 0.6
68 0.59
69 0.54
70 0.48
71 0.42
72 0.36
73 0.35
74 0.33
75 0.25
76 0.15
77 0.12
78 0.1
79 0.09
80 0.07
81 0.09
82 0.08
83 0.09
84 0.1
85 0.11
86 0.12
87 0.12
88 0.14
89 0.17
90 0.2
91 0.2
92 0.19
93 0.19
94 0.17
95 0.17
96 0.14
97 0.1
98 0.07
99 0.06
100 0.06
101 0.05
102 0.04
103 0.05
104 0.05
105 0.05
106 0.05
107 0.04
108 0.06
109 0.06
110 0.07
111 0.06
112 0.06
113 0.06
114 0.06
115 0.07
116 0.06
117 0.05
118 0.05
119 0.05
120 0.05
121 0.06
122 0.06
123 0.07
124 0.07
125 0.07
126 0.09
127 0.14
128 0.17
129 0.19
130 0.22
131 0.28
132 0.32
133 0.38
134 0.38
135 0.34
136 0.33
137 0.35
138 0.32
139 0.27
140 0.24
141 0.19
142 0.18
143 0.18
144 0.15
145 0.12
146 0.14
147 0.13
148 0.11
149 0.11
150 0.11
151 0.11
152 0.11
153 0.11
154 0.08
155 0.09
156 0.09
157 0.09
158 0.1
159 0.11
160 0.12
161 0.11
162 0.1
163 0.11
164 0.12
165 0.12
166 0.11
167 0.12
168 0.12
169 0.14
170 0.14
171 0.15
172 0.15
173 0.15
174 0.15
175 0.13
176 0.15
177 0.15
178 0.15
179 0.15
180 0.16
181 0.2
182 0.19
183 0.19
184 0.17
185 0.16
186 0.19
187 0.22
188 0.22
189 0.22
190 0.24
191 0.27
192 0.3
193 0.31
194 0.3
195 0.27
196 0.28
197 0.25
198 0.25
199 0.26
200 0.22
201 0.21
202 0.21
203 0.22
204 0.21
205 0.22
206 0.22
207 0.21
208 0.24
209 0.27
210 0.34
211 0.4
212 0.42
213 0.46
214 0.49
215 0.51
216 0.53
217 0.55
218 0.52
219 0.53
220 0.52
221 0.51
222 0.48
223 0.46
224 0.41
225 0.38
226 0.35
227 0.32
228 0.38
229 0.45
230 0.51
231 0.56