Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165GCG3

Protein Details
Accession A0A165GCG3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
86-105LEQKEKEREREKKRTRSEAGBasic
NLS Segment(s)
PositionSequence
89-100KEKEREREKKRT
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039715  ZCCHC10  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05110  AF-4  
PF13917  zf-CCHC_3  
Amino Acid Sequences MSKFAPHRRGTNAPRATSSTVCQKCLGTGHFTYECKGSRPYISRPSRTEQLEKPKLAEKMREKLAIAGPGPAPGSSSVKGTADKILEQKEKEREREKKRTRSEAGSSSSGSDSDSGSDSDSDSGSSTSGSKEYYVAKVWRSGKSELEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.56
4 0.48
5 0.44
6 0.44
7 0.39
8 0.39
9 0.37
10 0.32
11 0.3
12 0.32
13 0.31
14 0.26
15 0.24
16 0.28
17 0.3
18 0.31
19 0.3
20 0.3
21 0.29
22 0.26
23 0.27
24 0.24
25 0.26
26 0.31
27 0.36
28 0.42
29 0.49
30 0.53
31 0.54
32 0.58
33 0.58
34 0.57
35 0.56
36 0.53
37 0.56
38 0.57
39 0.53
40 0.49
41 0.48
42 0.49
43 0.45
44 0.46
45 0.41
46 0.4
47 0.44
48 0.43
49 0.38
50 0.36
51 0.36
52 0.3
53 0.25
54 0.2
55 0.16
56 0.15
57 0.15
58 0.12
59 0.1
60 0.08
61 0.1
62 0.09
63 0.1
64 0.1
65 0.11
66 0.12
67 0.12
68 0.13
69 0.12
70 0.13
71 0.15
72 0.19
73 0.22
74 0.23
75 0.27
76 0.34
77 0.38
78 0.43
79 0.49
80 0.54
81 0.6
82 0.7
83 0.75
84 0.76
85 0.8
86 0.83
87 0.78
88 0.75
89 0.72
90 0.67
91 0.62
92 0.54
93 0.46
94 0.39
95 0.34
96 0.27
97 0.21
98 0.15
99 0.11
100 0.09
101 0.1
102 0.09
103 0.09
104 0.1
105 0.1
106 0.1
107 0.1
108 0.09
109 0.09
110 0.09
111 0.08
112 0.08
113 0.08
114 0.09
115 0.1
116 0.1
117 0.1
118 0.12
119 0.15
120 0.18
121 0.23
122 0.25
123 0.26
124 0.34
125 0.38
126 0.42
127 0.43
128 0.43