Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2H890

Protein Details
Accession I2H890    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
217-242IDKRYAQTIERRRKRKSGARSICAFPHydrophilic
NLS Segment(s)
PositionSequence
227-234RRRKRKSG
Subcellular Location(s) mito 16, nucl 10, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039848  Ribosomal_S24/S35  
IPR019349  Ribosomal_S24/S35_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG tbl:TBLA_0H03110  -  
Pfam View protein in Pfam  
PF10213  MRP-S28  
Amino Acid Sequences MFRGILTKPSSPFQLCMPVLRVSKISNSVQSRAFSSFLPTNNKETSTKKGITSSNKAKEILLQEKSTLPKFDFDELPSIAQDLVDQHREQRFYNRIAAYELPLLVKFRQEYIPPSTDSVLSFRYTTYPGEETTPGSVPAASKVVLTISMDKLKYSDKEKHKLAILSGTNYNPITKTFKFSCNKYQNKLENKYYLINIWNQLITELKDTSDMFEDVPIDKRYAQTIERRRKRKSGARSICAFPKEWERPEDAPKKLFNFFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.35
4 0.35
5 0.36
6 0.35
7 0.36
8 0.35
9 0.27
10 0.31
11 0.33
12 0.33
13 0.35
14 0.37
15 0.39
16 0.41
17 0.4
18 0.39
19 0.35
20 0.33
21 0.25
22 0.27
23 0.28
24 0.29
25 0.36
26 0.35
27 0.38
28 0.39
29 0.42
30 0.4
31 0.4
32 0.42
33 0.41
34 0.42
35 0.38
36 0.42
37 0.46
38 0.5
39 0.56
40 0.58
41 0.59
42 0.59
43 0.58
44 0.52
45 0.5
46 0.49
47 0.47
48 0.41
49 0.34
50 0.32
51 0.35
52 0.38
53 0.35
54 0.3
55 0.23
56 0.23
57 0.24
58 0.27
59 0.25
60 0.23
61 0.25
62 0.23
63 0.23
64 0.19
65 0.18
66 0.14
67 0.11
68 0.1
69 0.09
70 0.11
71 0.13
72 0.13
73 0.17
74 0.2
75 0.22
76 0.23
77 0.28
78 0.3
79 0.3
80 0.37
81 0.33
82 0.31
83 0.31
84 0.31
85 0.25
86 0.21
87 0.19
88 0.13
89 0.12
90 0.13
91 0.11
92 0.12
93 0.1
94 0.11
95 0.13
96 0.14
97 0.17
98 0.21
99 0.23
100 0.22
101 0.23
102 0.22
103 0.2
104 0.19
105 0.17
106 0.13
107 0.12
108 0.11
109 0.1
110 0.11
111 0.11
112 0.11
113 0.12
114 0.12
115 0.11
116 0.13
117 0.14
118 0.13
119 0.13
120 0.13
121 0.11
122 0.1
123 0.1
124 0.08
125 0.08
126 0.09
127 0.07
128 0.06
129 0.06
130 0.06
131 0.06
132 0.07
133 0.08
134 0.09
135 0.12
136 0.13
137 0.12
138 0.13
139 0.16
140 0.18
141 0.21
142 0.28
143 0.32
144 0.4
145 0.42
146 0.44
147 0.45
148 0.43
149 0.39
150 0.38
151 0.31
152 0.27
153 0.27
154 0.24
155 0.23
156 0.22
157 0.22
158 0.15
159 0.16
160 0.19
161 0.17
162 0.23
163 0.24
164 0.33
165 0.37
166 0.41
167 0.5
168 0.54
169 0.6
170 0.6
171 0.66
172 0.66
173 0.71
174 0.74
175 0.68
176 0.62
177 0.58
178 0.55
179 0.47
180 0.4
181 0.33
182 0.29
183 0.25
184 0.22
185 0.2
186 0.17
187 0.17
188 0.16
189 0.15
190 0.15
191 0.13
192 0.12
193 0.14
194 0.14
195 0.15
196 0.16
197 0.15
198 0.13
199 0.13
200 0.14
201 0.13
202 0.18
203 0.18
204 0.17
205 0.17
206 0.18
207 0.21
208 0.23
209 0.26
210 0.32
211 0.41
212 0.51
213 0.6
214 0.67
215 0.71
216 0.76
217 0.82
218 0.81
219 0.82
220 0.82
221 0.83
222 0.82
223 0.81
224 0.77
225 0.75
226 0.67
227 0.58
228 0.5
229 0.5
230 0.5
231 0.49
232 0.47
233 0.46
234 0.48
235 0.57
236 0.62
237 0.57
238 0.55
239 0.56
240 0.57