Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H3J0

Protein Details
Accession I2H3J0    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MVTKNKNPKSKRSTKKSKKASVIEKLVKDHydrophilic
NLS Segment(s)
PositionSequence
6-20KNPKSKRSTKKSKKA
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
KEGG tbl:TBLA_0D04460  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12246  RRM1_U1A_like  
Amino Acid Sequences MVTKNKNPKSKRSTKKSKKASVIEKLVKDVATPESTSENLPTNETLYIRNIPEKLLPSQVRINLYLLLSTFGEIIYIKVGKPRSSLRGQAFVTFRTIDEAHVAKTALDQELFFGQSLHLEFSRQPSRIPDASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.93
3 0.93
4 0.92
5 0.91
6 0.9
7 0.89
8 0.87
9 0.85
10 0.82
11 0.73
12 0.66
13 0.58
14 0.48
15 0.38
16 0.31
17 0.24
18 0.19
19 0.17
20 0.16
21 0.16
22 0.17
23 0.17
24 0.17
25 0.17
26 0.16
27 0.17
28 0.16
29 0.15
30 0.15
31 0.15
32 0.15
33 0.14
34 0.16
35 0.16
36 0.18
37 0.17
38 0.17
39 0.18
40 0.2
41 0.18
42 0.23
43 0.23
44 0.23
45 0.26
46 0.28
47 0.27
48 0.25
49 0.25
50 0.18
51 0.18
52 0.15
53 0.11
54 0.1
55 0.08
56 0.07
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.1
66 0.12
67 0.12
68 0.15
69 0.19
70 0.23
71 0.27
72 0.34
73 0.34
74 0.39
75 0.39
76 0.41
77 0.39
78 0.34
79 0.33
80 0.26
81 0.23
82 0.19
83 0.19
84 0.14
85 0.17
86 0.17
87 0.15
88 0.16
89 0.16
90 0.12
91 0.13
92 0.14
93 0.12
94 0.11
95 0.1
96 0.11
97 0.13
98 0.14
99 0.12
100 0.1
101 0.09
102 0.11
103 0.12
104 0.13
105 0.12
106 0.13
107 0.14
108 0.22
109 0.29
110 0.28
111 0.29
112 0.31
113 0.38