Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165FEM3

Protein Details
Accession A0A165FEM3    Localization Confidence High Confidence Score 19.3
NoLS Segment(s)
PositionSequenceProtein Nature
195-226TQKPDKPYKHRDGAKKPRKPKKQDEWDNDNADBasic
270-291RGRGRGGKKVSNKARTRRTSASBasic
NLS Segment(s)
PositionSequence
163-171RRPPPKGKK
200-216KPYKHRDGAKKPRKPKK
249-287KKEKPSTQRGGKSGRGGADRGRGRGRGGKKVSNKARTRR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MDNSLGLDVTGAVDVPSPDPPPADAQPASPPPATPASATSKPQQQLQQPQGEKKVPYVNKNRVQTGGAPREKLSPEELEAKMAEIRKRNQLIKEKRELVLADEAAFKQQLAEDEAGRKARDDNTRKVQAKVNQERGQNAQRKLEKMGGREWDSAKGDDWSQARRPPPKGKKPTEELEPSPSDGNWKAAQQEQEGTQKPDKPYKHRDGAKKPRKPKKQDEWDNDNADKPEGEDAIERSESSASEDEWGQKKEKPSTQRGGKSGRGGADRGRGRGRGGKKVSNKARTRRTSASTDEDEGPTEPIAVMMPKTPPGGFKPLEVDVAQTNWAGDVIDESGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.11
4 0.12
5 0.13
6 0.14
7 0.15
8 0.2
9 0.21
10 0.26
11 0.24
12 0.25
13 0.32
14 0.35
15 0.37
16 0.32
17 0.3
18 0.28
19 0.31
20 0.3
21 0.23
22 0.24
23 0.28
24 0.32
25 0.35
26 0.36
27 0.41
28 0.42
29 0.46
30 0.48
31 0.49
32 0.55
33 0.59
34 0.64
35 0.61
36 0.65
37 0.67
38 0.65
39 0.57
40 0.52
41 0.54
42 0.5
43 0.54
44 0.58
45 0.61
46 0.64
47 0.69
48 0.66
49 0.59
50 0.55
51 0.53
52 0.53
53 0.53
54 0.49
55 0.45
56 0.44
57 0.47
58 0.46
59 0.4
60 0.34
61 0.26
62 0.25
63 0.3
64 0.29
65 0.25
66 0.24
67 0.23
68 0.23
69 0.25
70 0.26
71 0.25
72 0.29
73 0.36
74 0.42
75 0.46
76 0.51
77 0.58
78 0.64
79 0.66
80 0.72
81 0.67
82 0.62
83 0.6
84 0.52
85 0.44
86 0.39
87 0.31
88 0.22
89 0.2
90 0.19
91 0.17
92 0.17
93 0.13
94 0.08
95 0.09
96 0.09
97 0.1
98 0.11
99 0.12
100 0.14
101 0.17
102 0.19
103 0.18
104 0.17
105 0.16
106 0.21
107 0.3
108 0.34
109 0.39
110 0.46
111 0.56
112 0.57
113 0.58
114 0.58
115 0.54
116 0.59
117 0.6
118 0.61
119 0.57
120 0.56
121 0.56
122 0.55
123 0.57
124 0.53
125 0.47
126 0.45
127 0.43
128 0.43
129 0.43
130 0.45
131 0.39
132 0.34
133 0.36
134 0.34
135 0.34
136 0.35
137 0.34
138 0.31
139 0.3
140 0.28
141 0.24
142 0.2
143 0.16
144 0.17
145 0.18
146 0.17
147 0.18
148 0.22
149 0.26
150 0.31
151 0.37
152 0.44
153 0.53
154 0.6
155 0.67
156 0.7
157 0.71
158 0.7
159 0.68
160 0.64
161 0.59
162 0.5
163 0.45
164 0.39
165 0.34
166 0.29
167 0.25
168 0.21
169 0.17
170 0.18
171 0.14
172 0.13
173 0.14
174 0.16
175 0.18
176 0.16
177 0.17
178 0.17
179 0.23
180 0.24
181 0.27
182 0.27
183 0.3
184 0.32
185 0.38
186 0.4
187 0.42
188 0.49
189 0.54
190 0.6
191 0.62
192 0.69
193 0.73
194 0.79
195 0.82
196 0.81
197 0.84
198 0.85
199 0.88
200 0.88
201 0.87
202 0.87
203 0.88
204 0.89
205 0.88
206 0.86
207 0.83
208 0.79
209 0.69
210 0.61
211 0.5
212 0.4
213 0.3
214 0.22
215 0.17
216 0.11
217 0.11
218 0.1
219 0.1
220 0.13
221 0.13
222 0.12
223 0.12
224 0.12
225 0.11
226 0.13
227 0.13
228 0.1
229 0.11
230 0.13
231 0.18
232 0.22
233 0.24
234 0.23
235 0.26
236 0.31
237 0.38
238 0.43
239 0.46
240 0.5
241 0.58
242 0.65
243 0.69
244 0.69
245 0.68
246 0.66
247 0.63
248 0.58
249 0.52
250 0.45
251 0.4
252 0.37
253 0.4
254 0.38
255 0.38
256 0.38
257 0.34
258 0.35
259 0.42
260 0.44
261 0.45
262 0.48
263 0.53
264 0.57
265 0.67
266 0.73
267 0.75
268 0.78
269 0.78
270 0.83
271 0.81
272 0.81
273 0.77
274 0.73
275 0.69
276 0.66
277 0.64
278 0.57
279 0.54
280 0.49
281 0.42
282 0.38
283 0.33
284 0.28
285 0.21
286 0.17
287 0.12
288 0.1
289 0.1
290 0.09
291 0.09
292 0.1
293 0.12
294 0.14
295 0.16
296 0.17
297 0.19
298 0.23
299 0.3
300 0.29
301 0.3
302 0.32
303 0.32
304 0.35
305 0.31
306 0.29
307 0.23
308 0.23
309 0.22
310 0.17
311 0.15
312 0.12
313 0.12
314 0.1
315 0.08
316 0.08