Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165NFC0

Protein Details
Accession A0A165NFC0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MRGKNKAYAWKRQRVKRGQRSFASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MRGKNKAYAWKRQRVKRGQRSFASVRSVAISCALSGGCVRTAAVKNTMVVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.86
4 0.87
5 0.85
6 0.78
7 0.77
8 0.71
9 0.64
10 0.57
11 0.46
12 0.36
13 0.3
14 0.27
15 0.2
16 0.17
17 0.13
18 0.08
19 0.09
20 0.08
21 0.06
22 0.07
23 0.08
24 0.07
25 0.07
26 0.07
27 0.13
28 0.16
29 0.19
30 0.23
31 0.23