Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165I267

Protein Details
Accession A0A165I267    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
149-169SSAHVKREDHRDERRRFKREDBasic
171-190SDDRRARDPRLAKRQRVERSBasic
NLS Segment(s)
PositionSequence
159-188RDERRRFKREDMSDDRRARDPRLAKRQRVE
Subcellular Location(s) nucl 17.5, cyto_nucl 14.333, mito_nucl 10.832, cyto 7
Family & Domain DBs
Amino Acid Sequences MYPAAVECGIPSMNERLELQVPPKAAPPPPASPPQPSPTLAPSTPPPQDKTPSQDPPRFKQDPYEEEAHQQDALHSDTKVKDEPADDKSFFARVKQELSEEKKVTVKNEPGVQVKREVRFADDVKPNVKLEQDDVKPRIKAEHDVKQESSAHVKREDHRDERRRFKREDMSDDRRARDPRLAKRQRVERS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.19
4 0.21
5 0.23
6 0.24
7 0.23
8 0.24
9 0.23
10 0.26
11 0.26
12 0.26
13 0.3
14 0.33
15 0.34
16 0.37
17 0.44
18 0.43
19 0.45
20 0.48
21 0.46
22 0.44
23 0.4
24 0.38
25 0.35
26 0.38
27 0.32
28 0.29
29 0.29
30 0.32
31 0.35
32 0.36
33 0.36
34 0.34
35 0.39
36 0.4
37 0.44
38 0.46
39 0.51
40 0.55
41 0.58
42 0.59
43 0.6
44 0.66
45 0.61
46 0.52
47 0.51
48 0.51
49 0.48
50 0.48
51 0.45
52 0.37
53 0.38
54 0.39
55 0.31
56 0.24
57 0.2
58 0.15
59 0.13
60 0.14
61 0.12
62 0.1
63 0.12
64 0.13
65 0.15
66 0.16
67 0.14
68 0.14
69 0.14
70 0.18
71 0.2
72 0.24
73 0.22
74 0.21
75 0.22
76 0.23
77 0.22
78 0.19
79 0.18
80 0.14
81 0.16
82 0.16
83 0.18
84 0.21
85 0.27
86 0.33
87 0.3
88 0.3
89 0.32
90 0.32
91 0.32
92 0.31
93 0.28
94 0.25
95 0.28
96 0.3
97 0.32
98 0.34
99 0.33
100 0.34
101 0.36
102 0.34
103 0.34
104 0.31
105 0.27
106 0.3
107 0.3
108 0.31
109 0.32
110 0.32
111 0.3
112 0.33
113 0.31
114 0.27
115 0.27
116 0.2
117 0.18
118 0.24
119 0.26
120 0.3
121 0.33
122 0.36
123 0.36
124 0.35
125 0.36
126 0.31
127 0.36
128 0.35
129 0.41
130 0.44
131 0.48
132 0.48
133 0.48
134 0.47
135 0.41
136 0.43
137 0.37
138 0.34
139 0.34
140 0.38
141 0.4
142 0.49
143 0.55
144 0.54
145 0.61
146 0.68
147 0.73
148 0.79
149 0.84
150 0.81
151 0.77
152 0.77
153 0.77
154 0.75
155 0.76
156 0.74
157 0.73
158 0.76
159 0.77
160 0.72
161 0.69
162 0.63
163 0.57
164 0.57
165 0.58
166 0.58
167 0.64
168 0.71
169 0.72
170 0.78