Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165DD98

Protein Details
Accession A0A165DD98    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-118KGEKMRMRIENRKRIKEQNFMSHydrophilic
NLS Segment(s)
PositionSequence
108-109RK
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MRAALHFCSRLAARTSSTVPRRPFHVSCVRRAANDAPAAEPQAERPVSSCPPSTVLVGLNWLKGQPPVLALPDEEYPPWLWTITSAKPIPDDGPGGKGEKMRMRIENRKRIKEQNFMSKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.36
4 0.41
5 0.45
6 0.46
7 0.46
8 0.49
9 0.52
10 0.49
11 0.48
12 0.52
13 0.48
14 0.5
15 0.57
16 0.54
17 0.46
18 0.49
19 0.43
20 0.38
21 0.37
22 0.31
23 0.24
24 0.23
25 0.23
26 0.2
27 0.18
28 0.13
29 0.15
30 0.15
31 0.13
32 0.13
33 0.16
34 0.18
35 0.2
36 0.2
37 0.15
38 0.18
39 0.19
40 0.18
41 0.15
42 0.13
43 0.11
44 0.14
45 0.13
46 0.11
47 0.1
48 0.09
49 0.09
50 0.08
51 0.09
52 0.06
53 0.07
54 0.08
55 0.09
56 0.09
57 0.09
58 0.11
59 0.11
60 0.11
61 0.1
62 0.1
63 0.1
64 0.1
65 0.1
66 0.09
67 0.07
68 0.09
69 0.14
70 0.15
71 0.2
72 0.2
73 0.2
74 0.21
75 0.23
76 0.21
77 0.19
78 0.2
79 0.15
80 0.17
81 0.18
82 0.19
83 0.2
84 0.21
85 0.24
86 0.27
87 0.32
88 0.34
89 0.4
90 0.47
91 0.56
92 0.64
93 0.7
94 0.74
95 0.78
96 0.8
97 0.82
98 0.81
99 0.8
100 0.78