Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165CKF5

Protein Details
Accession A0A165CKF5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-22KPTCCQCLHARSTRRRAPKAFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
Amino Acid Sequences MKPTCCQCLHARSTRRRAPKAFGPSTHPAARVTFVARILGDVWFHAPVRALAKNVEKAWYYHYTYGRESGHVLHGVGLQSLFWPSTTGEGMGFKMLDRWVNFVVHGHPGDEAWKVKPRSVPLWRIEQIQAAEDVLKEMRGEWAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.81
4 0.78
5 0.75
6 0.75
7 0.75
8 0.71
9 0.65
10 0.62
11 0.6
12 0.61
13 0.56
14 0.48
15 0.39
16 0.34
17 0.33
18 0.27
19 0.23
20 0.19
21 0.17
22 0.17
23 0.15
24 0.15
25 0.14
26 0.13
27 0.1
28 0.09
29 0.09
30 0.09
31 0.09
32 0.09
33 0.09
34 0.1
35 0.13
36 0.14
37 0.14
38 0.16
39 0.19
40 0.23
41 0.23
42 0.24
43 0.21
44 0.2
45 0.24
46 0.26
47 0.25
48 0.26
49 0.28
50 0.28
51 0.29
52 0.32
53 0.28
54 0.24
55 0.22
56 0.18
57 0.16
58 0.14
59 0.13
60 0.1
61 0.1
62 0.1
63 0.09
64 0.07
65 0.05
66 0.05
67 0.06
68 0.05
69 0.04
70 0.05
71 0.05
72 0.07
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.08
80 0.06
81 0.08
82 0.08
83 0.11
84 0.11
85 0.14
86 0.15
87 0.16
88 0.16
89 0.16
90 0.16
91 0.17
92 0.17
93 0.14
94 0.12
95 0.12
96 0.13
97 0.15
98 0.15
99 0.15
100 0.23
101 0.23
102 0.27
103 0.31
104 0.35
105 0.41
106 0.48
107 0.52
108 0.49
109 0.57
110 0.55
111 0.55
112 0.51
113 0.46
114 0.39
115 0.32
116 0.29
117 0.2
118 0.19
119 0.15
120 0.16
121 0.11
122 0.11
123 0.1
124 0.09