Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H8M8

Protein Details
Accession I2H8M8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-25NDEERRKKRLARFAVNTDTRKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR000717  PCI_dom  
IPR045107  SAC3/GANP/THP3  
IPR005062  SAC3/GANP/THP3_conserved  
Gene Ontology GO:0043170  P:macromolecule metabolic process  
GO:0006807  P:nitrogen compound metabolic process  
GO:0044238  P:primary metabolic process  
KEGG tbl:TBLA_0I00720  -  
Pfam View protein in Pfam  
PF03399  SAC3_GANP  
PROSITE View protein in PROSITE  
PS50250  PCI  
Amino Acid Sequences MKLDNDEERRKKRLARFAVNTDTRKATDKIRTNKTDSIIVGCFQTISKPYMRLTSEPNPEFIRPIHILKKAYETFLNEKINKEIEYSRFISEFKSIRQDLTIQRIRDEFTVKVYESNIEISIENEDFNEFNQCITQLIPLYSEVKEQAENDKRLQFIKYNMIRLIFLKEWDSLIEMFIRYKLNQNEKQIMLEWELFDAKIVGDYYKLAQTIESISEKNMLMGKLLEYYLKNERNNIIRVLILSYNQLNFEMLKEKLYFNNIENLGKYLIENKKYQEFIEKKVLENGKELQILNSRKIRLQNSDNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.75
4 0.77
5 0.82
6 0.81
7 0.75
8 0.68
9 0.61
10 0.53
11 0.49
12 0.43
13 0.41
14 0.42
15 0.49
16 0.55
17 0.61
18 0.66
19 0.68
20 0.71
21 0.66
22 0.61
23 0.53
24 0.48
25 0.39
26 0.33
27 0.27
28 0.22
29 0.19
30 0.14
31 0.16
32 0.13
33 0.15
34 0.17
35 0.2
36 0.21
37 0.27
38 0.3
39 0.29
40 0.35
41 0.4
42 0.47
43 0.45
44 0.47
45 0.43
46 0.41
47 0.41
48 0.34
49 0.31
50 0.25
51 0.29
52 0.32
53 0.34
54 0.36
55 0.35
56 0.43
57 0.38
58 0.38
59 0.35
60 0.34
61 0.33
62 0.39
63 0.45
64 0.38
65 0.38
66 0.38
67 0.38
68 0.33
69 0.31
70 0.28
71 0.24
72 0.27
73 0.28
74 0.27
75 0.25
76 0.25
77 0.24
78 0.25
79 0.24
80 0.21
81 0.26
82 0.25
83 0.24
84 0.25
85 0.28
86 0.27
87 0.34
88 0.38
89 0.31
90 0.32
91 0.32
92 0.32
93 0.3
94 0.29
95 0.2
96 0.17
97 0.2
98 0.18
99 0.18
100 0.18
101 0.17
102 0.14
103 0.15
104 0.12
105 0.1
106 0.1
107 0.09
108 0.11
109 0.1
110 0.09
111 0.08
112 0.08
113 0.07
114 0.07
115 0.1
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.08
122 0.08
123 0.07
124 0.07
125 0.07
126 0.08
127 0.1
128 0.1
129 0.1
130 0.1
131 0.1
132 0.1
133 0.1
134 0.18
135 0.23
136 0.25
137 0.26
138 0.28
139 0.27
140 0.28
141 0.29
142 0.22
143 0.19
144 0.26
145 0.26
146 0.27
147 0.27
148 0.27
149 0.26
150 0.25
151 0.26
152 0.17
153 0.15
154 0.14
155 0.13
156 0.13
157 0.12
158 0.13
159 0.09
160 0.09
161 0.09
162 0.07
163 0.07
164 0.09
165 0.1
166 0.09
167 0.16
168 0.21
169 0.3
170 0.35
171 0.39
172 0.43
173 0.42
174 0.43
175 0.38
176 0.33
177 0.27
178 0.22
179 0.17
180 0.13
181 0.13
182 0.12
183 0.1
184 0.09
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.07
191 0.08
192 0.1
193 0.1
194 0.09
195 0.08
196 0.09
197 0.1
198 0.13
199 0.13
200 0.12
201 0.12
202 0.15
203 0.15
204 0.15
205 0.16
206 0.13
207 0.12
208 0.12
209 0.12
210 0.11
211 0.12
212 0.13
213 0.11
214 0.15
215 0.23
216 0.29
217 0.29
218 0.31
219 0.35
220 0.38
221 0.4
222 0.38
223 0.31
224 0.25
225 0.24
226 0.24
227 0.21
228 0.16
229 0.16
230 0.16
231 0.16
232 0.16
233 0.15
234 0.13
235 0.12
236 0.13
237 0.15
238 0.14
239 0.16
240 0.17
241 0.18
242 0.2
243 0.24
244 0.25
245 0.22
246 0.3
247 0.29
248 0.3
249 0.29
250 0.28
251 0.25
252 0.23
253 0.22
254 0.22
255 0.27
256 0.29
257 0.31
258 0.33
259 0.39
260 0.4
261 0.41
262 0.43
263 0.4
264 0.42
265 0.5
266 0.48
267 0.42
268 0.5
269 0.54
270 0.45
271 0.45
272 0.43
273 0.38
274 0.4
275 0.39
276 0.34
277 0.38
278 0.4
279 0.43
280 0.45
281 0.42
282 0.43
283 0.5
284 0.52
285 0.52