Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165N5X1

Protein Details
Accession A0A165N5X1    Localization Confidence High Confidence Score 22.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-55AEHASVKKRKHDGEHKDRSPKKPKKEKDAPAPAPTKRKKDKSKGKERAAAAGBasic
290-323SLPTPEPTDKEKEKKKRKKDKKRKAGEEEEEEAQBasic
326-348VDEVQPETSSKKKRKKKDKEAAEBasic
NLS Segment(s)
PositionSequence
10-51KKRKHDGEHKDRSPKKPKKEKDAPAPAPTKRKKDKSKGKERA
299-314KEKEKKKRKKDKKRKA
336-345KKKRKKKDKE
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036898  RNA_pol_Rpb7-like_N_sf  
IPR041178  RPA43_OB  
IPR045113  Rpb7-like  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0005730  C:nucleolus  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF17875  RPA43_OB  
Amino Acid Sequences MAPAEHASVKKRKHDGEHKDRSPKKPKKEKDAPAPAPTKRKKDKSKGKERAAAAGPSEFRYVQGETVISIPPSHAGNPVACANEMLDSMMMRYIPALEGVMLAHSDLRFLQEKASLVGACPFAVCTIGFRALVWGPTIGMKLKGKISLCSPDHVSLLVHRTFNVSIPRHHIPTDDYEFMWGAAPNDPEFGLEAEDDATTTAAAPAEDDDEPAEVDVDASKNDRWIRRDNGELLGDETGHLEFTVIGLKLANQMLSLVGSIQEDPFSPAHVPVAAITDASMDVDPPAPEASLPTPEPTDKEKEKKKRKKDKKRKAGEEEEEEAQVEVDEVQPETSSKKKRKKKDKEAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.8
4 0.85
5 0.85
6 0.87
7 0.89
8 0.88
9 0.89
10 0.87
11 0.87
12 0.87
13 0.88
14 0.88
15 0.91
16 0.91
17 0.91
18 0.92
19 0.88
20 0.86
21 0.84
22 0.79
23 0.79
24 0.77
25 0.76
26 0.75
27 0.79
28 0.81
29 0.84
30 0.89
31 0.89
32 0.93
33 0.93
34 0.92
35 0.9
36 0.81
37 0.78
38 0.71
39 0.62
40 0.52
41 0.46
42 0.38
43 0.32
44 0.33
45 0.24
46 0.21
47 0.21
48 0.2
49 0.16
50 0.16
51 0.14
52 0.12
53 0.14
54 0.14
55 0.11
56 0.1
57 0.1
58 0.1
59 0.11
60 0.11
61 0.12
62 0.13
63 0.13
64 0.16
65 0.18
66 0.18
67 0.16
68 0.16
69 0.14
70 0.13
71 0.12
72 0.1
73 0.08
74 0.06
75 0.07
76 0.07
77 0.07
78 0.05
79 0.05
80 0.06
81 0.05
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06
91 0.05
92 0.06
93 0.06
94 0.09
95 0.11
96 0.11
97 0.12
98 0.14
99 0.15
100 0.15
101 0.17
102 0.14
103 0.12
104 0.15
105 0.13
106 0.11
107 0.1
108 0.09
109 0.07
110 0.08
111 0.07
112 0.06
113 0.08
114 0.09
115 0.09
116 0.09
117 0.11
118 0.11
119 0.11
120 0.1
121 0.09
122 0.07
123 0.08
124 0.09
125 0.08
126 0.11
127 0.11
128 0.13
129 0.14
130 0.18
131 0.18
132 0.19
133 0.21
134 0.25
135 0.25
136 0.26
137 0.27
138 0.24
139 0.23
140 0.22
141 0.2
142 0.13
143 0.17
144 0.16
145 0.14
146 0.13
147 0.15
148 0.15
149 0.17
150 0.22
151 0.2
152 0.19
153 0.25
154 0.27
155 0.26
156 0.26
157 0.24
158 0.19
159 0.23
160 0.26
161 0.21
162 0.19
163 0.18
164 0.18
165 0.17
166 0.16
167 0.11
168 0.07
169 0.08
170 0.09
171 0.08
172 0.09
173 0.09
174 0.08
175 0.08
176 0.07
177 0.06
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.07
198 0.06
199 0.06
200 0.04
201 0.04
202 0.05
203 0.05
204 0.05
205 0.07
206 0.07
207 0.11
208 0.16
209 0.2
210 0.23
211 0.3
212 0.35
213 0.37
214 0.42
215 0.4
216 0.39
217 0.37
218 0.33
219 0.27
220 0.22
221 0.18
222 0.14
223 0.12
224 0.08
225 0.07
226 0.06
227 0.05
228 0.04
229 0.05
230 0.08
231 0.07
232 0.07
233 0.07
234 0.07
235 0.1
236 0.11
237 0.11
238 0.08
239 0.08
240 0.08
241 0.08
242 0.08
243 0.05
244 0.05
245 0.06
246 0.06
247 0.06
248 0.07
249 0.07
250 0.1
251 0.1
252 0.11
253 0.11
254 0.11
255 0.12
256 0.12
257 0.11
258 0.09
259 0.12
260 0.1
261 0.09
262 0.09
263 0.09
264 0.08
265 0.09
266 0.08
267 0.05
268 0.06
269 0.08
270 0.08
271 0.09
272 0.09
273 0.08
274 0.08
275 0.11
276 0.12
277 0.15
278 0.16
279 0.16
280 0.19
281 0.2
282 0.23
283 0.25
284 0.32
285 0.36
286 0.45
287 0.54
288 0.62
289 0.73
290 0.8
291 0.87
292 0.9
293 0.93
294 0.95
295 0.96
296 0.97
297 0.96
298 0.97
299 0.96
300 0.95
301 0.95
302 0.92
303 0.88
304 0.81
305 0.72
306 0.61
307 0.5
308 0.4
309 0.29
310 0.2
311 0.13
312 0.09
313 0.08
314 0.08
315 0.08
316 0.09
317 0.09
318 0.1
319 0.14
320 0.22
321 0.31
322 0.4
323 0.5
324 0.6
325 0.71
326 0.81
327 0.89
328 0.92