Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165K9R2

Protein Details
Accession A0A165K9R2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
37-62EKVARLKKKKSGRAGMRQRYNKRFTNHydrophilic
NLS Segment(s)
PositionSequence
39-57VARLKKKKSGRAGMRQRYN
Subcellular Location(s) nucl 14, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MKASVECKNPPASNNAMAAHGSLTKSGRVKAMTPVVEKVARLKKKKSGRAGMRQRYNKRFTNVTMTPGRRRRLNPND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.27
4 0.25
5 0.23
6 0.19
7 0.16
8 0.13
9 0.11
10 0.11
11 0.14
12 0.15
13 0.16
14 0.18
15 0.17
16 0.18
17 0.22
18 0.26
19 0.25
20 0.25
21 0.25
22 0.25
23 0.24
24 0.23
25 0.24
26 0.27
27 0.32
28 0.34
29 0.37
30 0.44
31 0.52
32 0.61
33 0.64
34 0.65
35 0.68
36 0.75
37 0.82
38 0.83
39 0.83
40 0.85
41 0.85
42 0.84
43 0.81
44 0.76
45 0.7
46 0.65
47 0.58
48 0.58
49 0.51
50 0.48
51 0.51
52 0.5
53 0.55
54 0.59
55 0.61
56 0.59
57 0.63