Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165Q635

Protein Details
Accession A0A165Q635    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-49KTSVQSKAGDRRHRRVRDKKPAPYVPAHydrophilic
NLS Segment(s)
PositionSequence
32-42DRRHRRVRDKK
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MPSHETGRRISHIDVLKSTTNHKTSVQSKAGDRRHRRVRDKKPAPYVPAVDIKPQVATRKTYTMRPYIRNAGHVISLEREAMAALRASGFICRAGQHASCKVEGPSIRLLPEQATVACYEPRLQSPPYDSRKPFEMRDAHVTCKSCRRDLCLKGPFWRYNDRLNAHVRLCRAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.38
4 0.36
5 0.39
6 0.4
7 0.36
8 0.35
9 0.35
10 0.39
11 0.39
12 0.47
13 0.47
14 0.43
15 0.47
16 0.54
17 0.61
18 0.63
19 0.67
20 0.68
21 0.73
22 0.79
23 0.84
24 0.85
25 0.87
26 0.88
27 0.9
28 0.89
29 0.89
30 0.85
31 0.8
32 0.74
33 0.65
34 0.58
35 0.54
36 0.46
37 0.39
38 0.34
39 0.29
40 0.26
41 0.25
42 0.26
43 0.22
44 0.25
45 0.24
46 0.31
47 0.33
48 0.36
49 0.38
50 0.42
51 0.45
52 0.46
53 0.47
54 0.47
55 0.47
56 0.43
57 0.4
58 0.32
59 0.28
60 0.24
61 0.2
62 0.13
63 0.13
64 0.1
65 0.08
66 0.07
67 0.06
68 0.06
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.07
81 0.09
82 0.11
83 0.13
84 0.17
85 0.18
86 0.18
87 0.19
88 0.18
89 0.2
90 0.19
91 0.19
92 0.19
93 0.19
94 0.19
95 0.19
96 0.19
97 0.16
98 0.16
99 0.14
100 0.1
101 0.09
102 0.09
103 0.1
104 0.1
105 0.1
106 0.11
107 0.12
108 0.14
109 0.17
110 0.17
111 0.18
112 0.24
113 0.32
114 0.38
115 0.44
116 0.43
117 0.43
118 0.49
119 0.51
120 0.47
121 0.46
122 0.44
123 0.4
124 0.49
125 0.49
126 0.47
127 0.48
128 0.49
129 0.44
130 0.48
131 0.47
132 0.44
133 0.44
134 0.47
135 0.51
136 0.56
137 0.63
138 0.62
139 0.62
140 0.63
141 0.69
142 0.67
143 0.62
144 0.64
145 0.57
146 0.58
147 0.62
148 0.58
149 0.55
150 0.56
151 0.58
152 0.52
153 0.53