Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165I6S6

Protein Details
Accession A0A165I6S6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
65-86NSHLRSARIRGRARKKPLPGSVHydrophilic
NLS Segment(s)
PositionSequence
71-82ARIRGRARKKPL
Subcellular Location(s) nucl 19.5, cyto_nucl 12.833, mito_nucl 12.166, cyto 4
Family & Domain DBs
Amino Acid Sequences MCTTRPTRVSRTSSRAATTPTYSPNSRDSKESCFPIPRPLAFWLPLPNSMCTLFTNEDCTQNAFNSHLRSARIRGRARKKPLPGSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.52
3 0.47
4 0.43
5 0.38
6 0.34
7 0.32
8 0.33
9 0.32
10 0.32
11 0.36
12 0.38
13 0.36
14 0.38
15 0.36
16 0.38
17 0.41
18 0.42
19 0.38
20 0.37
21 0.36
22 0.39
23 0.4
24 0.32
25 0.31
26 0.3
27 0.29
28 0.25
29 0.25
30 0.21
31 0.19
32 0.22
33 0.21
34 0.19
35 0.18
36 0.18
37 0.18
38 0.14
39 0.17
40 0.15
41 0.14
42 0.2
43 0.19
44 0.22
45 0.21
46 0.23
47 0.2
48 0.2
49 0.2
50 0.17
51 0.19
52 0.2
53 0.22
54 0.22
55 0.24
56 0.27
57 0.32
58 0.37
59 0.43
60 0.48
61 0.56
62 0.64
63 0.71
64 0.78
65 0.81
66 0.83