Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165CUK1

Protein Details
Accession A0A165CUK1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
38-74PSSDRCHTARSWRRPRWRPWRRLGRRPDRHQLQHCVAHydrophilic
160-180AHHPHRRRGVHRRSRHHLDRCBasic
NLS Segment(s)
PositionSequence
49-64WRRPRWRPWRRLGRRP
Subcellular Location(s) extr 12, mito 5, plas 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MLLLLATPALRPRLVPLPLPGCVVIAICLAVGPSLLTPSSDRCHTARSWRRPRWRPWRRLGRRPDRHQLQHCVAHGLWHCFPDGHDYRLGELEHDYYASGRDAHHAVSHDYVAYSFVFNPERDTRSVHCYRFLRGPRGTSCEGVEPRLPVESEPHLAACAHHPHRRRGVHRRSRHHLDRCAQVEVPLVALVPGPSRAHRLAAGLRQAQWRCSDWRYDRGRLRQRQHPAQHVRTGRCARPSGARLHRRPRSVPLCEPAAVRRRSHCEPRAAGFVPCAEQRLWPPVRPRARLLSRDPSPRRTLSAYPRSGTPALIIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.34
4 0.36
5 0.37
6 0.38
7 0.34
8 0.26
9 0.24
10 0.21
11 0.15
12 0.1
13 0.09
14 0.07
15 0.06
16 0.06
17 0.05
18 0.05
19 0.04
20 0.04
21 0.06
22 0.06
23 0.07
24 0.09
25 0.13
26 0.17
27 0.19
28 0.22
29 0.22
30 0.26
31 0.29
32 0.38
33 0.45
34 0.52
35 0.61
36 0.68
37 0.78
38 0.83
39 0.9
40 0.91
41 0.91
42 0.9
43 0.9
44 0.92
45 0.91
46 0.91
47 0.92
48 0.92
49 0.92
50 0.9
51 0.9
52 0.88
53 0.87
54 0.85
55 0.82
56 0.77
57 0.72
58 0.65
59 0.58
60 0.48
61 0.44
62 0.4
63 0.37
64 0.31
65 0.26
66 0.25
67 0.21
68 0.22
69 0.25
70 0.24
71 0.21
72 0.23
73 0.23
74 0.24
75 0.26
76 0.26
77 0.18
78 0.16
79 0.15
80 0.12
81 0.12
82 0.11
83 0.08
84 0.09
85 0.09
86 0.08
87 0.07
88 0.1
89 0.1
90 0.11
91 0.13
92 0.13
93 0.14
94 0.14
95 0.14
96 0.12
97 0.11
98 0.1
99 0.09
100 0.08
101 0.08
102 0.07
103 0.09
104 0.11
105 0.11
106 0.16
107 0.19
108 0.21
109 0.21
110 0.24
111 0.24
112 0.3
113 0.37
114 0.33
115 0.36
116 0.35
117 0.36
118 0.41
119 0.43
120 0.42
121 0.38
122 0.42
123 0.37
124 0.42
125 0.41
126 0.34
127 0.3
128 0.29
129 0.27
130 0.25
131 0.23
132 0.17
133 0.16
134 0.16
135 0.15
136 0.1
137 0.12
138 0.11
139 0.12
140 0.11
141 0.11
142 0.1
143 0.1
144 0.1
145 0.1
146 0.16
147 0.19
148 0.24
149 0.27
150 0.32
151 0.4
152 0.46
153 0.52
154 0.55
155 0.62
156 0.68
157 0.74
158 0.78
159 0.78
160 0.8
161 0.82
162 0.79
163 0.75
164 0.69
165 0.68
166 0.62
167 0.56
168 0.47
169 0.38
170 0.32
171 0.24
172 0.2
173 0.12
174 0.09
175 0.06
176 0.06
177 0.06
178 0.05
179 0.06
180 0.07
181 0.08
182 0.12
183 0.12
184 0.13
185 0.14
186 0.16
187 0.18
188 0.21
189 0.26
190 0.23
191 0.26
192 0.31
193 0.31
194 0.3
195 0.3
196 0.29
197 0.28
198 0.28
199 0.34
200 0.31
201 0.4
202 0.45
203 0.5
204 0.55
205 0.62
206 0.7
207 0.71
208 0.73
209 0.72
210 0.75
211 0.77
212 0.76
213 0.76
214 0.75
215 0.71
216 0.73
217 0.71
218 0.65
219 0.64
220 0.64
221 0.57
222 0.53
223 0.5
224 0.44
225 0.46
226 0.47
227 0.47
228 0.51
229 0.57
230 0.6
231 0.68
232 0.73
233 0.71
234 0.7
235 0.71
236 0.69
237 0.67
238 0.64
239 0.59
240 0.56
241 0.51
242 0.49
243 0.46
244 0.46
245 0.43
246 0.4
247 0.41
248 0.45
249 0.51
250 0.59
251 0.59
252 0.59
253 0.59
254 0.6
255 0.62
256 0.56
257 0.49
258 0.4
259 0.35
260 0.3
261 0.26
262 0.24
263 0.18
264 0.18
265 0.21
266 0.29
267 0.31
268 0.33
269 0.4
270 0.47
271 0.56
272 0.58
273 0.6
274 0.61
275 0.66
276 0.68
277 0.68
278 0.69
279 0.67
280 0.73
281 0.74
282 0.71
283 0.69
284 0.65
285 0.62
286 0.57
287 0.58
288 0.58
289 0.62
290 0.61
291 0.56
292 0.56
293 0.57
294 0.52
295 0.44