Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H1N3

Protein Details
Accession I2H1N3    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
132-155STNTNENKKIKNKNNNVNNNNNANHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 12.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0032991  C:protein-containing complex  
GO:0043170  P:macromolecule metabolic process  
GO:0006807  P:nitrogen compound metabolic process  
GO:0044238  P:primary metabolic process  
KEGG tbl:TBLA_0C04890  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01717  Sm_B  
Amino Acid Sequences MNNISVKHNSRLSHLINYKIRVITIDDKVYIGELLSFDNHMNLILNNCIEQRIPKTQLPKLKDLKSKDSIRIEKRTLGLIILRGDQILTTMVEDKPLLNKSQRLQKEKQQSKIISKNRRSRYYNSKTNKSSSTNTNENKKIKNKNNNVNNNNNANTRPAGNPTNKPVVRKFQPPPGFVKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.51
4 0.53
5 0.53
6 0.46
7 0.42
8 0.34
9 0.35
10 0.32
11 0.32
12 0.31
13 0.27
14 0.27
15 0.26
16 0.26
17 0.2
18 0.13
19 0.09
20 0.07
21 0.07
22 0.08
23 0.09
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.07
30 0.08
31 0.09
32 0.09
33 0.09
34 0.1
35 0.1
36 0.1
37 0.12
38 0.15
39 0.21
40 0.25
41 0.27
42 0.34
43 0.38
44 0.45
45 0.47
46 0.51
47 0.52
48 0.55
49 0.59
50 0.58
51 0.6
52 0.61
53 0.61
54 0.59
55 0.6
56 0.6
57 0.6
58 0.61
59 0.56
60 0.51
61 0.48
62 0.42
63 0.33
64 0.26
65 0.21
66 0.16
67 0.15
68 0.13
69 0.11
70 0.1
71 0.09
72 0.08
73 0.08
74 0.06
75 0.05
76 0.04
77 0.06
78 0.06
79 0.07
80 0.07
81 0.07
82 0.1
83 0.11
84 0.12
85 0.13
86 0.16
87 0.19
88 0.28
89 0.35
90 0.38
91 0.41
92 0.47
93 0.56
94 0.6
95 0.64
96 0.63
97 0.6
98 0.62
99 0.68
100 0.7
101 0.69
102 0.71
103 0.74
104 0.74
105 0.79
106 0.75
107 0.73
108 0.75
109 0.74
110 0.74
111 0.73
112 0.73
113 0.69
114 0.68
115 0.67
116 0.6
117 0.55
118 0.53
119 0.52
120 0.52
121 0.54
122 0.58
123 0.61
124 0.61
125 0.65
126 0.66
127 0.7
128 0.7
129 0.75
130 0.77
131 0.79
132 0.84
133 0.87
134 0.86
135 0.84
136 0.81
137 0.76
138 0.7
139 0.62
140 0.52
141 0.45
142 0.39
143 0.33
144 0.28
145 0.27
146 0.31
147 0.35
148 0.4
149 0.43
150 0.52
151 0.51
152 0.54
153 0.55
154 0.58
155 0.58
156 0.61
157 0.61
158 0.61
159 0.67
160 0.64