Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2GYI9

Protein Details
Accession I2GYI9    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
62-81YHNMMKPKIKHNKPKFKTDEBasic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031456  Caf20  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005845  C:mRNA cap binding complex  
GO:0003743  F:translation initiation factor activity  
GO:0017148  P:negative regulation of translation  
KEGG tbl:TBLA_0B03500  -  
Pfam View protein in Pfam  
PF17052  CAF20  
Amino Acid Sequences MIENRYSIEELLQLKPSEIQPVDFDAVEFRAIIEKIKQVQLLKDEEFAHGGHFNRRRSSHHYHNMMKPKIKHNKPKFKTDENGWSTLDTSAKDESSAIEDDEQSSKSKKESSPGSFHEVVKVKPNNKNISSSRPADTKDIVADKQTLNFNAFAALESESDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.25
4 0.27
5 0.24
6 0.23
7 0.2
8 0.25
9 0.26
10 0.22
11 0.22
12 0.16
13 0.16
14 0.15
15 0.13
16 0.09
17 0.1
18 0.11
19 0.12
20 0.13
21 0.16
22 0.19
23 0.22
24 0.25
25 0.23
26 0.26
27 0.29
28 0.31
29 0.28
30 0.28
31 0.27
32 0.24
33 0.24
34 0.21
35 0.18
36 0.16
37 0.16
38 0.21
39 0.26
40 0.28
41 0.33
42 0.35
43 0.38
44 0.43
45 0.51
46 0.53
47 0.57
48 0.62
49 0.62
50 0.67
51 0.72
52 0.69
53 0.66
54 0.6
55 0.6
56 0.62
57 0.65
58 0.68
59 0.69
60 0.76
61 0.74
62 0.8
63 0.77
64 0.72
65 0.68
66 0.62
67 0.61
68 0.53
69 0.51
70 0.41
71 0.35
72 0.3
73 0.26
74 0.23
75 0.13
76 0.12
77 0.1
78 0.1
79 0.1
80 0.09
81 0.08
82 0.1
83 0.1
84 0.09
85 0.09
86 0.09
87 0.1
88 0.11
89 0.12
90 0.11
91 0.12
92 0.12
93 0.13
94 0.18
95 0.18
96 0.23
97 0.31
98 0.35
99 0.41
100 0.44
101 0.49
102 0.47
103 0.46
104 0.47
105 0.41
106 0.37
107 0.39
108 0.42
109 0.41
110 0.45
111 0.53
112 0.54
113 0.53
114 0.6
115 0.55
116 0.57
117 0.57
118 0.53
119 0.49
120 0.45
121 0.45
122 0.42
123 0.39
124 0.33
125 0.32
126 0.32
127 0.29
128 0.28
129 0.29
130 0.25
131 0.28
132 0.3
133 0.27
134 0.25
135 0.24
136 0.22
137 0.2
138 0.2
139 0.15
140 0.13
141 0.12
142 0.1