Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165BU16

Protein Details
Accession A0A165BU16   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
238-278GSMGYKARAKRSKAGKKVRKGKGKGKGKKSKKTPKADRAALBasic
NLS Segment(s)
PositionSequence
34-75RRKGLRIGGGGRPASRPPSRPPIVIKPKPTIIKKPHPTIIKK
243-276KARAKRSKAGKKVRKGKGKGKGKKSKKTPKADRA
Subcellular Location(s) extr 21, mito 3, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MQRLGLLFFFSTLFLAVFIQAVPLDGESETTLVRRKGLRIGGGGRPASRPPSRPPIVIKPKPTIIKKPHPTIIKKPHSETTIKKSTTHTESHSSTTPPSSQSATTPPSSQTHTTTSAPAASHTTTPPGGTLTGTGSASHSATRTSDPEATDTDLPNLPSVPTKTKKGLHWPTGASGEPLVQGGGLWRNLPGVSLSFDPSGAGWCRKIKVNIGAPGTGGIYGGGYGGGYGDTSGYPSDGSMGYKARAKRSKAGKKVRKGKGKGKGKKSKKTPKADRAAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.07
5 0.07
6 0.07
7 0.06
8 0.07
9 0.07
10 0.07
11 0.07
12 0.07
13 0.08
14 0.08
15 0.09
16 0.09
17 0.1
18 0.15
19 0.14
20 0.19
21 0.2
22 0.22
23 0.28
24 0.33
25 0.35
26 0.35
27 0.4
28 0.41
29 0.45
30 0.44
31 0.38
32 0.36
33 0.35
34 0.37
35 0.36
36 0.35
37 0.36
38 0.44
39 0.46
40 0.48
41 0.52
42 0.56
43 0.62
44 0.65
45 0.64
46 0.59
47 0.63
48 0.67
49 0.65
50 0.64
51 0.63
52 0.67
53 0.69
54 0.71
55 0.71
56 0.71
57 0.72
58 0.73
59 0.74
60 0.73
61 0.7
62 0.67
63 0.65
64 0.61
65 0.6
66 0.56
67 0.54
68 0.53
69 0.49
70 0.47
71 0.45
72 0.47
73 0.46
74 0.44
75 0.39
76 0.35
77 0.36
78 0.38
79 0.36
80 0.31
81 0.28
82 0.26
83 0.24
84 0.19
85 0.19
86 0.18
87 0.16
88 0.17
89 0.2
90 0.21
91 0.21
92 0.2
93 0.21
94 0.21
95 0.24
96 0.24
97 0.22
98 0.22
99 0.25
100 0.25
101 0.23
102 0.22
103 0.21
104 0.19
105 0.17
106 0.15
107 0.12
108 0.13
109 0.12
110 0.13
111 0.11
112 0.11
113 0.11
114 0.09
115 0.09
116 0.07
117 0.08
118 0.07
119 0.08
120 0.08
121 0.08
122 0.07
123 0.08
124 0.08
125 0.08
126 0.07
127 0.06
128 0.07
129 0.09
130 0.09
131 0.11
132 0.13
133 0.13
134 0.14
135 0.15
136 0.16
137 0.16
138 0.15
139 0.15
140 0.14
141 0.14
142 0.12
143 0.11
144 0.09
145 0.11
146 0.13
147 0.18
148 0.2
149 0.23
150 0.28
151 0.32
152 0.36
153 0.44
154 0.5
155 0.49
156 0.5
157 0.47
158 0.44
159 0.43
160 0.39
161 0.29
162 0.21
163 0.15
164 0.11
165 0.1
166 0.08
167 0.05
168 0.05
169 0.05
170 0.08
171 0.08
172 0.08
173 0.08
174 0.08
175 0.09
176 0.09
177 0.08
178 0.07
179 0.09
180 0.1
181 0.12
182 0.11
183 0.11
184 0.11
185 0.1
186 0.13
187 0.13
188 0.14
189 0.15
190 0.18
191 0.2
192 0.25
193 0.28
194 0.3
195 0.36
196 0.42
197 0.45
198 0.44
199 0.42
200 0.38
201 0.36
202 0.3
203 0.22
204 0.14
205 0.08
206 0.05
207 0.05
208 0.04
209 0.04
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.04
217 0.04
218 0.05
219 0.06
220 0.06
221 0.06
222 0.06
223 0.08
224 0.08
225 0.09
226 0.11
227 0.13
228 0.15
229 0.21
230 0.25
231 0.34
232 0.4
233 0.44
234 0.5
235 0.59
236 0.68
237 0.73
238 0.81
239 0.81
240 0.84
241 0.9
242 0.91
243 0.91
244 0.89
245 0.88
246 0.87
247 0.89
248 0.88
249 0.88
250 0.89
251 0.89
252 0.91
253 0.92
254 0.93
255 0.92
256 0.93
257 0.93
258 0.93