Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165MMV0

Protein Details
Accession A0A165MMV0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRLQRSVKKYKRARLPTLPISLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF00646  F-box  
PROSITE View protein in PROSITE  
PS50181  FBOX  
Amino Acid Sequences MRLQRSVKKYKRARLPTLPISLLRRLLEHCDLLDRIALAQTCVTLRQAAQSIPALWCKFRIHDYSALHKASYLFHWSYPRLVDVALSLSMDGPLGALEKPCFPDLRPFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.8
4 0.77
5 0.7
6 0.63
7 0.58
8 0.52
9 0.45
10 0.37
11 0.31
12 0.26
13 0.29
14 0.28
15 0.24
16 0.21
17 0.21
18 0.2
19 0.19
20 0.18
21 0.13
22 0.1
23 0.11
24 0.1
25 0.07
26 0.07
27 0.07
28 0.07
29 0.08
30 0.08
31 0.07
32 0.07
33 0.08
34 0.09
35 0.09
36 0.1
37 0.11
38 0.11
39 0.11
40 0.15
41 0.13
42 0.12
43 0.15
44 0.14
45 0.14
46 0.17
47 0.19
48 0.19
49 0.25
50 0.28
51 0.32
52 0.37
53 0.36
54 0.33
55 0.3
56 0.28
57 0.22
58 0.21
59 0.19
60 0.15
61 0.17
62 0.21
63 0.21
64 0.22
65 0.22
66 0.21
67 0.16
68 0.15
69 0.13
70 0.1
71 0.11
72 0.1
73 0.09
74 0.08
75 0.08
76 0.08
77 0.07
78 0.06
79 0.04
80 0.04
81 0.05
82 0.06
83 0.08
84 0.09
85 0.11
86 0.15
87 0.17
88 0.18
89 0.19