Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165PIK8

Protein Details
Accession A0A165PIK8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
190-213YGIPPPGRYPRRRNPLKLNKLHLGHydrophilic
234-263PVRCTLLSSRPRPRRMTRTRRTSRFAFGRRHydrophilic
NLS Segment(s)
PositionSequence
244-257PRPRRMTRTRRTSR
Subcellular Location(s) nucl 7.5, mito 6, extr 6, cyto_nucl 6, cyto 3.5, plas 3
Family & Domain DBs
Amino Acid Sequences MSTILYLAFYLPVVVPAEQAGAIKITLNYELSVNILNNSAIPSTGPPSGPTTRRRNPDTMNVPTRSTEPPPYPFPRRRKDLLEGPAPGSKIRYGAPPPLGMMPRRLYASKIGECPPPEDEEEEEVESKIRYGALPPLGMMPRRRNPSTFGVPPVEDVEEKDSKMHYGNPPAGPVARRLNPQTLYAPIMHYGIPPPGRYPRRRNPLKLNKLHLGTPPAGRYPRRLDPVKLAGSSPVRCTLLSSRPRPRRMTRTRRTSRFAFGRRHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.11
5 0.1
6 0.11
7 0.09
8 0.08
9 0.08
10 0.09
11 0.09
12 0.1
13 0.11
14 0.12
15 0.12
16 0.11
17 0.12
18 0.11
19 0.13
20 0.12
21 0.11
22 0.11
23 0.11
24 0.1
25 0.12
26 0.1
27 0.08
28 0.08
29 0.09
30 0.11
31 0.14
32 0.14
33 0.14
34 0.2
35 0.26
36 0.31
37 0.38
38 0.45
39 0.51
40 0.58
41 0.62
42 0.63
43 0.62
44 0.66
45 0.66
46 0.65
47 0.65
48 0.59
49 0.55
50 0.49
51 0.48
52 0.41
53 0.37
54 0.34
55 0.31
56 0.33
57 0.39
58 0.45
59 0.51
60 0.56
61 0.62
62 0.65
63 0.67
64 0.67
65 0.66
66 0.66
67 0.66
68 0.64
69 0.6
70 0.53
71 0.49
72 0.46
73 0.41
74 0.34
75 0.26
76 0.2
77 0.15
78 0.14
79 0.16
80 0.17
81 0.21
82 0.23
83 0.22
84 0.23
85 0.25
86 0.26
87 0.22
88 0.23
89 0.2
90 0.2
91 0.21
92 0.21
93 0.18
94 0.22
95 0.27
96 0.26
97 0.27
98 0.28
99 0.29
100 0.29
101 0.3
102 0.26
103 0.22
104 0.2
105 0.18
106 0.17
107 0.15
108 0.16
109 0.15
110 0.14
111 0.11
112 0.11
113 0.1
114 0.08
115 0.07
116 0.06
117 0.05
118 0.05
119 0.09
120 0.1
121 0.1
122 0.1
123 0.12
124 0.13
125 0.15
126 0.18
127 0.21
128 0.26
129 0.32
130 0.33
131 0.32
132 0.36
133 0.4
134 0.43
135 0.39
136 0.36
137 0.32
138 0.31
139 0.31
140 0.27
141 0.22
142 0.15
143 0.14
144 0.15
145 0.14
146 0.14
147 0.14
148 0.13
149 0.13
150 0.14
151 0.18
152 0.17
153 0.22
154 0.27
155 0.26
156 0.27
157 0.27
158 0.28
159 0.23
160 0.24
161 0.24
162 0.23
163 0.25
164 0.27
165 0.32
166 0.32
167 0.34
168 0.31
169 0.27
170 0.26
171 0.24
172 0.22
173 0.17
174 0.17
175 0.14
176 0.13
177 0.12
178 0.14
179 0.15
180 0.15
181 0.17
182 0.26
183 0.34
184 0.42
185 0.51
186 0.56
187 0.66
188 0.74
189 0.79
190 0.81
191 0.84
192 0.87
193 0.85
194 0.82
195 0.78
196 0.71
197 0.66
198 0.58
199 0.52
200 0.44
201 0.39
202 0.35
203 0.33
204 0.37
205 0.35
206 0.38
207 0.4
208 0.46
209 0.5
210 0.52
211 0.5
212 0.53
213 0.6
214 0.58
215 0.52
216 0.44
217 0.42
218 0.44
219 0.42
220 0.36
221 0.33
222 0.3
223 0.29
224 0.32
225 0.33
226 0.36
227 0.44
228 0.5
229 0.56
230 0.64
231 0.72
232 0.76
233 0.8
234 0.81
235 0.83
236 0.86
237 0.85
238 0.87
239 0.9
240 0.91
241 0.88
242 0.82
243 0.81
244 0.8
245 0.77