Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166MVR0

Protein Details
Accession A0A166MVR0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-31YLVADGRRIRQRRCTRRRCTSERWCMYEDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 3, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013320  ConA-like_dom_sf  
Amino Acid Sequences MQYLVADGRRIRQRRCTRRRCTSERWCMYEDETRAAPETGPGSVSIRFFGFSAIPVCFAKGCTAVPFNDKRFSVSINTTETYGPGNVFVLDAIHIPFGCSVWPAYWTAARVWPTGGEIDIMEQTNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.79
3 0.82
4 0.82
5 0.87
6 0.93
7 0.9
8 0.89
9 0.89
10 0.89
11 0.86
12 0.81
13 0.71
14 0.63
15 0.58
16 0.54
17 0.45
18 0.37
19 0.3
20 0.25
21 0.25
22 0.23
23 0.19
24 0.14
25 0.14
26 0.1
27 0.1
28 0.1
29 0.1
30 0.11
31 0.12
32 0.11
33 0.1
34 0.1
35 0.1
36 0.1
37 0.08
38 0.08
39 0.09
40 0.08
41 0.1
42 0.09
43 0.1
44 0.09
45 0.09
46 0.09
47 0.08
48 0.08
49 0.08
50 0.1
51 0.1
52 0.15
53 0.18
54 0.2
55 0.23
56 0.23
57 0.23
58 0.23
59 0.24
60 0.22
61 0.21
62 0.21
63 0.2
64 0.2
65 0.19
66 0.19
67 0.17
68 0.15
69 0.13
70 0.11
71 0.08
72 0.08
73 0.07
74 0.07
75 0.06
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.07
84 0.07
85 0.06
86 0.07
87 0.07
88 0.07
89 0.09
90 0.1
91 0.12
92 0.14
93 0.15
94 0.16
95 0.21
96 0.22
97 0.21
98 0.21
99 0.2
100 0.19
101 0.19
102 0.17
103 0.13
104 0.11
105 0.12
106 0.13