Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165PAX8

Protein Details
Accession A0A165PAX8    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
141-166ITGIWCFMRRRRRRRRAKILDLPISRHydrophilic
NLS Segment(s)
PositionSequence
149-159RRRRRRRRAKI
Subcellular Location(s) nucl 11cyto_nucl 11, cyto 9, mito 3, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSDKFTSLSMSFETPTIAHRDDDQSVNINNVQNDGGGDTNIINNNNNNGASASGNDSMGGAGGDAGHTVDGSSTSNGPTAVLPDSAAGASQPVTFIVTTVIVQQPATTSDLAAPESLAVSSEIIIALLAAILSAGFVIGAITGIWCFMRRRRRRRRAKILDLPISREGRKPDDDSVIEIDKGPIRPFQVPVTTTPVDDDTGRQSKLDRLREYLAKQEQTLPETPHEVSTPVTVVGSGSAAGDSYAYSDSATAVGQPVPGGSGSVRSSVGNRQSRFLTVPHGHTFPRALPKTPKSTTFPRASVPPGLTDYIRDNNNSTSPRTPASTARDEPKDVWKQITSTVDVQQSPTSPPQLLPQRNNTLTFIPTRPAPSPPRPVPQRTNTLPTRASRPPLPAAAPSPSGCAMWNPPEAVMHVMRQHAVETM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.21
4 0.21
5 0.19
6 0.22
7 0.27
8 0.29
9 0.31
10 0.31
11 0.3
12 0.29
13 0.31
14 0.31
15 0.3
16 0.27
17 0.25
18 0.23
19 0.19
20 0.18
21 0.17
22 0.13
23 0.1
24 0.1
25 0.09
26 0.13
27 0.16
28 0.17
29 0.17
30 0.18
31 0.21
32 0.24
33 0.23
34 0.2
35 0.17
36 0.17
37 0.16
38 0.15
39 0.16
40 0.15
41 0.14
42 0.14
43 0.13
44 0.12
45 0.11
46 0.1
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.07
59 0.08
60 0.09
61 0.1
62 0.11
63 0.11
64 0.11
65 0.11
66 0.11
67 0.11
68 0.11
69 0.1
70 0.09
71 0.1
72 0.09
73 0.09
74 0.07
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.1
87 0.12
88 0.11
89 0.11
90 0.11
91 0.11
92 0.12
93 0.14
94 0.11
95 0.09
96 0.11
97 0.12
98 0.13
99 0.12
100 0.1
101 0.08
102 0.08
103 0.07
104 0.06
105 0.05
106 0.05
107 0.05
108 0.06
109 0.05
110 0.05
111 0.05
112 0.04
113 0.03
114 0.03
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.03
129 0.03
130 0.03
131 0.03
132 0.05
133 0.07
134 0.14
135 0.25
136 0.35
137 0.47
138 0.58
139 0.69
140 0.79
141 0.89
142 0.94
143 0.94
144 0.94
145 0.93
146 0.91
147 0.89
148 0.79
149 0.72
150 0.65
151 0.58
152 0.48
153 0.41
154 0.35
155 0.31
156 0.32
157 0.31
158 0.28
159 0.3
160 0.29
161 0.28
162 0.28
163 0.24
164 0.21
165 0.18
166 0.17
167 0.14
168 0.15
169 0.14
170 0.13
171 0.14
172 0.15
173 0.17
174 0.18
175 0.19
176 0.19
177 0.2
178 0.25
179 0.23
180 0.22
181 0.21
182 0.19
183 0.16
184 0.16
185 0.15
186 0.13
187 0.16
188 0.16
189 0.16
190 0.16
191 0.21
192 0.28
193 0.34
194 0.3
195 0.3
196 0.33
197 0.37
198 0.38
199 0.39
200 0.36
201 0.3
202 0.29
203 0.3
204 0.28
205 0.27
206 0.29
207 0.23
208 0.19
209 0.21
210 0.21
211 0.17
212 0.16
213 0.13
214 0.11
215 0.1
216 0.1
217 0.07
218 0.07
219 0.06
220 0.05
221 0.05
222 0.05
223 0.04
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.04
231 0.04
232 0.04
233 0.05
234 0.05
235 0.05
236 0.06
237 0.06
238 0.05
239 0.05
240 0.05
241 0.05
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.04
248 0.07
249 0.08
250 0.09
251 0.1
252 0.1
253 0.12
254 0.17
255 0.26
256 0.3
257 0.31
258 0.32
259 0.32
260 0.34
261 0.34
262 0.29
263 0.28
264 0.25
265 0.29
266 0.29
267 0.3
268 0.29
269 0.28
270 0.29
271 0.25
272 0.31
273 0.28
274 0.29
275 0.36
276 0.41
277 0.49
278 0.5
279 0.51
280 0.46
281 0.52
282 0.56
283 0.54
284 0.5
285 0.44
286 0.45
287 0.43
288 0.42
289 0.35
290 0.29
291 0.25
292 0.25
293 0.23
294 0.21
295 0.22
296 0.23
297 0.23
298 0.22
299 0.22
300 0.23
301 0.29
302 0.29
303 0.29
304 0.26
305 0.27
306 0.28
307 0.29
308 0.29
309 0.29
310 0.34
311 0.38
312 0.39
313 0.44
314 0.45
315 0.45
316 0.45
317 0.48
318 0.49
319 0.44
320 0.43
321 0.38
322 0.36
323 0.39
324 0.4
325 0.34
326 0.29
327 0.32
328 0.32
329 0.31
330 0.32
331 0.28
332 0.26
333 0.26
334 0.26
335 0.24
336 0.21
337 0.21
338 0.28
339 0.36
340 0.43
341 0.45
342 0.51
343 0.57
344 0.59
345 0.61
346 0.55
347 0.47
348 0.42
349 0.41
350 0.34
351 0.27
352 0.27
353 0.29
354 0.28
355 0.33
356 0.38
357 0.42
358 0.5
359 0.54
360 0.62
361 0.65
362 0.72
363 0.74
364 0.73
365 0.75
366 0.7
367 0.73
368 0.67
369 0.66
370 0.63
371 0.57
372 0.56
373 0.53
374 0.53
375 0.48
376 0.5
377 0.48
378 0.48
379 0.47
380 0.44
381 0.41
382 0.4
383 0.39
384 0.34
385 0.32
386 0.29
387 0.26
388 0.23
389 0.22
390 0.23
391 0.25
392 0.28
393 0.25
394 0.25
395 0.26
396 0.27
397 0.28
398 0.24
399 0.23
400 0.24
401 0.25
402 0.25
403 0.25