Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165DI71

Protein Details
Accession A0A165DI71   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
112-139PTRSRGSMSRRRTRRARRRTQSFALRTTHydrophilic
NLS Segment(s)
PositionSequence
113-142TRSRGSMSRRRTRRARRRTQSFALRTTRRR
Subcellular Location(s) nucl 15, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MRNHPEPVVAWARTRGWERDPQWRRRPDDPETVALPRVLLQTLAEQARRRAYLPFDAPVHNTAVLALIWTLSDALPCRPTLLPNFALRSRLRRPALTHSTSSARTLIPKLSPTRSRGSMSRRRTRRARRRTQSFALRTTRRRSRLMRSATSALITTTSRRTTTSRRCAHLAMLRQRVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.35
3 0.33
4 0.41
5 0.43
6 0.5
7 0.58
8 0.63
9 0.69
10 0.73
11 0.74
12 0.73
13 0.76
14 0.72
15 0.73
16 0.67
17 0.61
18 0.56
19 0.52
20 0.45
21 0.38
22 0.31
23 0.22
24 0.19
25 0.15
26 0.11
27 0.09
28 0.1
29 0.14
30 0.17
31 0.18
32 0.19
33 0.21
34 0.25
35 0.26
36 0.25
37 0.24
38 0.25
39 0.28
40 0.29
41 0.3
42 0.28
43 0.28
44 0.29
45 0.27
46 0.26
47 0.19
48 0.16
49 0.12
50 0.11
51 0.09
52 0.07
53 0.06
54 0.04
55 0.04
56 0.04
57 0.04
58 0.03
59 0.04
60 0.05
61 0.06
62 0.08
63 0.08
64 0.1
65 0.1
66 0.12
67 0.14
68 0.17
69 0.19
70 0.2
71 0.23
72 0.22
73 0.26
74 0.25
75 0.28
76 0.28
77 0.33
78 0.33
79 0.32
80 0.35
81 0.4
82 0.47
83 0.43
84 0.4
85 0.35
86 0.36
87 0.34
88 0.32
89 0.24
90 0.17
91 0.16
92 0.16
93 0.16
94 0.15
95 0.18
96 0.21
97 0.26
98 0.3
99 0.32
100 0.35
101 0.36
102 0.38
103 0.39
104 0.45
105 0.49
106 0.54
107 0.6
108 0.62
109 0.67
110 0.74
111 0.8
112 0.82
113 0.83
114 0.85
115 0.86
116 0.88
117 0.88
118 0.87
119 0.86
120 0.8
121 0.77
122 0.75
123 0.72
124 0.69
125 0.7
126 0.7
127 0.65
128 0.68
129 0.66
130 0.67
131 0.69
132 0.71
133 0.67
134 0.65
135 0.63
136 0.56
137 0.51
138 0.41
139 0.32
140 0.25
141 0.2
142 0.17
143 0.19
144 0.21
145 0.21
146 0.23
147 0.28
148 0.37
149 0.47
150 0.55
151 0.57
152 0.59
153 0.62
154 0.61
155 0.64
156 0.61
157 0.6
158 0.6
159 0.6