Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165L5J5

Protein Details
Accession A0A165L5J5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-32VVPIAHRNPRHLRRRGRITTSPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 3, plas 3
Family & Domain DBs
Amino Acid Sequences MDPALLRSLLVVPIAHRNPRHLRRRGRITTSPLAAQTSFSLLELAFAWHLVLEPVMYILSMHTYAIHVQLMPFHLRLFHHPRYGAEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.27
4 0.34
5 0.44
6 0.53
7 0.62
8 0.62
9 0.69
10 0.73
11 0.83
12 0.83
13 0.81
14 0.77
15 0.75
16 0.71
17 0.63
18 0.55
19 0.45
20 0.38
21 0.3
22 0.24
23 0.17
24 0.12
25 0.1
26 0.09
27 0.08
28 0.06
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.07
52 0.08
53 0.09
54 0.08
55 0.07
56 0.1
57 0.12
58 0.14
59 0.14
60 0.13
61 0.15
62 0.16
63 0.25
64 0.32
65 0.35
66 0.39
67 0.4