Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165JK52

Protein Details
Accession A0A165JK52    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
335-354GFAGGTRGRSPKPKKRPDNABasic
NLS Segment(s)
PositionSequence
340-351TRGRSPKPKKRP
Subcellular Location(s) cyto 13, nucl 11, mito 2
Family & Domain DBs
Amino Acid Sequences MPKSKYLAIIDTLGHARIELEPGLPKLEYRLLCVGRGLPVEGYPAVPLDPAHSESLERPAVVTSAPLPWPDCYVHTLEAFTACISRLHKSPQNVVSISKQDLHAVLKYSVYDQYRHGQEKVAAYEAAQAARPAASQPAYPDDVDASPAHSVHSYSSSSASGSGSDSGRTASPFQPRRMDLHMEMWLDLNAGHKLSDPKLLTSELDQLESIEKDWAMRIAHEIVTKRPRTSAWLRGVDAAGDPETADVAPPVVAGGVGTEDIDIGPEDAIEHRIERAAKSLEGYPPAKSNPHYPKVRTSTTATWSAKASALRTRTWDLAQALASRVSMFLMSLAKGFAGGTRGRSPKPKKRPDNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.16
3 0.15
4 0.13
5 0.15
6 0.12
7 0.13
8 0.15
9 0.17
10 0.19
11 0.18
12 0.17
13 0.18
14 0.24
15 0.23
16 0.24
17 0.32
18 0.31
19 0.32
20 0.33
21 0.31
22 0.28
23 0.28
24 0.25
25 0.17
26 0.16
27 0.18
28 0.17
29 0.15
30 0.12
31 0.12
32 0.1
33 0.1
34 0.1
35 0.1
36 0.12
37 0.14
38 0.15
39 0.15
40 0.16
41 0.17
42 0.23
43 0.22
44 0.19
45 0.17
46 0.16
47 0.16
48 0.14
49 0.14
50 0.09
51 0.12
52 0.13
53 0.14
54 0.15
55 0.15
56 0.18
57 0.18
58 0.19
59 0.18
60 0.2
61 0.21
62 0.2
63 0.19
64 0.17
65 0.17
66 0.15
67 0.12
68 0.1
69 0.08
70 0.11
71 0.12
72 0.14
73 0.16
74 0.23
75 0.28
76 0.31
77 0.38
78 0.4
79 0.44
80 0.42
81 0.42
82 0.4
83 0.39
84 0.37
85 0.31
86 0.26
87 0.22
88 0.22
89 0.22
90 0.19
91 0.18
92 0.17
93 0.16
94 0.16
95 0.16
96 0.19
97 0.19
98 0.18
99 0.18
100 0.24
101 0.3
102 0.32
103 0.31
104 0.29
105 0.31
106 0.33
107 0.32
108 0.27
109 0.21
110 0.18
111 0.21
112 0.19
113 0.17
114 0.13
115 0.11
116 0.1
117 0.1
118 0.1
119 0.06
120 0.08
121 0.08
122 0.08
123 0.09
124 0.13
125 0.14
126 0.14
127 0.14
128 0.13
129 0.12
130 0.14
131 0.13
132 0.1
133 0.09
134 0.09
135 0.09
136 0.08
137 0.08
138 0.07
139 0.1
140 0.09
141 0.09
142 0.11
143 0.11
144 0.1
145 0.11
146 0.1
147 0.08
148 0.08
149 0.09
150 0.08
151 0.08
152 0.08
153 0.08
154 0.08
155 0.09
156 0.11
157 0.13
158 0.22
159 0.26
160 0.29
161 0.33
162 0.34
163 0.36
164 0.37
165 0.37
166 0.3
167 0.28
168 0.28
169 0.24
170 0.23
171 0.2
172 0.16
173 0.13
174 0.11
175 0.09
176 0.06
177 0.06
178 0.06
179 0.07
180 0.09
181 0.1
182 0.16
183 0.15
184 0.15
185 0.17
186 0.18
187 0.16
188 0.16
189 0.21
190 0.15
191 0.16
192 0.15
193 0.14
194 0.14
195 0.14
196 0.13
197 0.08
198 0.07
199 0.07
200 0.07
201 0.09
202 0.08
203 0.08
204 0.1
205 0.11
206 0.13
207 0.16
208 0.17
209 0.21
210 0.29
211 0.31
212 0.29
213 0.29
214 0.28
215 0.32
216 0.37
217 0.4
218 0.4
219 0.42
220 0.43
221 0.43
222 0.42
223 0.35
224 0.29
225 0.22
226 0.13
227 0.09
228 0.08
229 0.06
230 0.06
231 0.06
232 0.05
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.03
244 0.04
245 0.03
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.05
254 0.05
255 0.08
256 0.08
257 0.08
258 0.08
259 0.12
260 0.13
261 0.13
262 0.17
263 0.18
264 0.18
265 0.2
266 0.23
267 0.23
268 0.28
269 0.28
270 0.25
271 0.26
272 0.28
273 0.29
274 0.28
275 0.35
276 0.39
277 0.47
278 0.52
279 0.52
280 0.6
281 0.63
282 0.66
283 0.6
284 0.57
285 0.54
286 0.52
287 0.58
288 0.5
289 0.44
290 0.41
291 0.39
292 0.36
293 0.32
294 0.3
295 0.27
296 0.29
297 0.29
298 0.33
299 0.35
300 0.35
301 0.34
302 0.37
303 0.31
304 0.31
305 0.31
306 0.28
307 0.26
308 0.23
309 0.22
310 0.16
311 0.15
312 0.13
313 0.1
314 0.08
315 0.09
316 0.1
317 0.1
318 0.1
319 0.1
320 0.09
321 0.1
322 0.1
323 0.09
324 0.11
325 0.13
326 0.17
327 0.25
328 0.31
329 0.35
330 0.46
331 0.55
332 0.62
333 0.71
334 0.77