Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165IJG5

Protein Details
Accession A0A165IJG5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
41-70GPSSRLSWRSRSRPRSRRKTLYLRRHSRFLHydrophilic
NLS Segment(s)
PositionSequence
49-59RSRSRPRSRRK
Subcellular Location(s) mito 12, cyto_nucl 7, nucl 6.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MARTSMSIAACNDDVPRASSSPRLLAECAARAIVDGLAATGPSSRLSWRSRSRPRSRRKTLYLRRHSRFLVTTAPRKVCWSCDGDIGRACGSSRSVLQSLLHSAALCCGRPRLSGPGRRREHAPSVGSVAPVCKNAQGSIVLSGGACTFTTIHWHGVAFLSRRCVLSDGRARNWCWRSAWVDFNPEGRSVLPGGAIWLETILSYLILPPATTVVRDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.19
4 0.17
5 0.18
6 0.23
7 0.24
8 0.28
9 0.29
10 0.29
11 0.27
12 0.28
13 0.3
14 0.27
15 0.25
16 0.2
17 0.17
18 0.15
19 0.15
20 0.11
21 0.08
22 0.06
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.06
30 0.07
31 0.09
32 0.15
33 0.18
34 0.27
35 0.36
36 0.46
37 0.56
38 0.66
39 0.75
40 0.8
41 0.87
42 0.9
43 0.91
44 0.9
45 0.89
46 0.89
47 0.89
48 0.9
49 0.9
50 0.89
51 0.83
52 0.78
53 0.7
54 0.63
55 0.54
56 0.45
57 0.44
58 0.39
59 0.42
60 0.44
61 0.44
62 0.4
63 0.42
64 0.4
65 0.33
66 0.31
67 0.28
68 0.22
69 0.27
70 0.28
71 0.26
72 0.27
73 0.25
74 0.22
75 0.18
76 0.17
77 0.11
78 0.11
79 0.1
80 0.09
81 0.11
82 0.11
83 0.12
84 0.12
85 0.12
86 0.13
87 0.13
88 0.12
89 0.09
90 0.09
91 0.1
92 0.11
93 0.1
94 0.09
95 0.09
96 0.09
97 0.1
98 0.12
99 0.18
100 0.24
101 0.32
102 0.38
103 0.47
104 0.5
105 0.51
106 0.52
107 0.48
108 0.48
109 0.45
110 0.39
111 0.3
112 0.31
113 0.3
114 0.27
115 0.22
116 0.18
117 0.13
118 0.13
119 0.13
120 0.1
121 0.1
122 0.1
123 0.12
124 0.11
125 0.11
126 0.11
127 0.11
128 0.1
129 0.09
130 0.09
131 0.08
132 0.07
133 0.06
134 0.05
135 0.05
136 0.05
137 0.1
138 0.12
139 0.13
140 0.13
141 0.13
142 0.13
143 0.15
144 0.19
145 0.16
146 0.16
147 0.19
148 0.2
149 0.21
150 0.21
151 0.22
152 0.19
153 0.26
154 0.33
155 0.35
156 0.41
157 0.45
158 0.46
159 0.53
160 0.55
161 0.49
162 0.43
163 0.41
164 0.4
165 0.4
166 0.46
167 0.39
168 0.42
169 0.4
170 0.42
171 0.38
172 0.34
173 0.3
174 0.23
175 0.22
176 0.17
177 0.15
178 0.12
179 0.1
180 0.11
181 0.1
182 0.1
183 0.08
184 0.07
185 0.06
186 0.06
187 0.06
188 0.05
189 0.05
190 0.05
191 0.06
192 0.07
193 0.08
194 0.08
195 0.08
196 0.11
197 0.11