Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165CHN2

Protein Details
Accession A0A165CHN2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-26VSSQSPRTRTCRNKNGNAARRSRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MSSVSSQSPRTRTCRNKNGNAARRSRSLHSDTARNALDSRRRWRQTKWSTSSSNSSNSMSGRSWRSAQDQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.75
3 0.78
4 0.83
5 0.88
6 0.87
7 0.84
8 0.8
9 0.73
10 0.69
11 0.63
12 0.55
13 0.5
14 0.45
15 0.44
16 0.4
17 0.41
18 0.37
19 0.38
20 0.36
21 0.3
22 0.26
23 0.23
24 0.28
25 0.28
26 0.34
27 0.39
28 0.44
29 0.47
30 0.52
31 0.59
32 0.63
33 0.68
34 0.68
35 0.65
36 0.64
37 0.64
38 0.65
39 0.57
40 0.51
41 0.43
42 0.37
43 0.33
44 0.29
45 0.29
46 0.24
47 0.27
48 0.27
49 0.28
50 0.29
51 0.31