Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165K3I0

Protein Details
Accession A0A165K3I0    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-26LLARCTRRPACSRHRQRRDAPGADQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 4.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009038  GOLD_dom  
Pfam View protein in Pfam  
PF01105  EMP24_GP25L  
Amino Acid Sequences MLLARCTRRPACSRHRQRRDAPGADQRIRHQSNRGSSGNARFAITTHSEDDVGVCFKNYFDYTVSSVNAVGESRVVDLDLDISVDAVEYNAIANKQSLSVLETEMRKVDGVVKEIVDEMEYLKRRELRFHSTNGTWEIMHLRAFFTRQYLIDYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.85
3 0.86
4 0.87
5 0.89
6 0.88
7 0.82
8 0.78
9 0.77
10 0.76
11 0.71
12 0.66
13 0.59
14 0.59
15 0.57
16 0.52
17 0.49
18 0.47
19 0.5
20 0.54
21 0.51
22 0.45
23 0.46
24 0.49
25 0.48
26 0.42
27 0.35
28 0.28
29 0.26
30 0.26
31 0.25
32 0.21
33 0.17
34 0.17
35 0.16
36 0.16
37 0.16
38 0.14
39 0.12
40 0.09
41 0.08
42 0.07
43 0.07
44 0.1
45 0.1
46 0.1
47 0.1
48 0.12
49 0.14
50 0.16
51 0.16
52 0.13
53 0.13
54 0.12
55 0.11
56 0.08
57 0.06
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.02
74 0.02
75 0.02
76 0.03
77 0.03
78 0.04
79 0.04
80 0.05
81 0.05
82 0.06
83 0.06
84 0.06
85 0.06
86 0.07
87 0.08
88 0.11
89 0.12
90 0.12
91 0.13
92 0.13
93 0.12
94 0.11
95 0.16
96 0.15
97 0.16
98 0.17
99 0.16
100 0.16
101 0.17
102 0.16
103 0.11
104 0.09
105 0.08
106 0.14
107 0.16
108 0.17
109 0.21
110 0.27
111 0.27
112 0.35
113 0.39
114 0.41
115 0.43
116 0.47
117 0.5
118 0.46
119 0.49
120 0.45
121 0.4
122 0.31
123 0.28
124 0.26
125 0.21
126 0.22
127 0.18
128 0.17
129 0.17
130 0.19
131 0.19
132 0.19
133 0.21
134 0.19