Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165CJZ8

Protein Details
Accession A0A165CJZ8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-62RKPVSRPKTPVKRPAPRPPVVBasic
NLS Segment(s)
PositionSequence
40-87VARKPVSRPKTPVKRPAPRPPVVRKPTPVKRPVPVRTPIKRPTPVKRP
Subcellular Location(s) extr 17, mito 3, cyto 2, plas 2, E.R. 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MTAFRRIVLLAVLYLALLTSAVPVLDNDAPDAANLAARGVARKPVSRPKTPVKRPAPRPPVVRKPTPVKRPVPVRTPIKRPTPVKRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.04
10 0.04
11 0.07
12 0.08
13 0.09
14 0.09
15 0.09
16 0.09
17 0.09
18 0.1
19 0.06
20 0.06
21 0.05
22 0.05
23 0.06
24 0.06
25 0.07
26 0.07
27 0.11
28 0.12
29 0.14
30 0.18
31 0.27
32 0.32
33 0.36
34 0.42
35 0.48
36 0.57
37 0.62
38 0.69
39 0.69
40 0.74
41 0.78
42 0.83
43 0.81
44 0.77
45 0.78
46 0.77
47 0.78
48 0.74
49 0.72
50 0.68
51 0.69
52 0.73
53 0.74
54 0.73
55 0.68
56 0.7
57 0.74
58 0.74
59 0.71
60 0.7
61 0.71
62 0.7
63 0.73
64 0.73
65 0.72
66 0.75
67 0.76