Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165CCJ3

Protein Details
Accession A0A165CCJ3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-33SLRVRHFPARSHARRRRRRPATYPISLRLRHydrophilic
NLS Segment(s)
PositionSequence
11-23PARSHARRRRRRP
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 9, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTGSLRVRHFPARSHARRRRRRPATYPISLRLRPTHFAHVPMTLTEARAPQATVSRSMDRTISGSFSFDSTSLDIPSRSRGLSRLRYIAEVLTRAFASDLRSLYIGFAHIHSVSSWTASPAAPPLALGAYSISGLASSPDTPSHVIRTGLSHFGTRLVRNNHKCCAYVPTRPEAMPRPSPSIPQATRAQARLPRTCATYFDFEDCPEAVAFDGNHACRRGVLVCLVPLAHNPRFRLLASRTVSPPPRRIRSVEMDLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.77
4 0.85
5 0.91
6 0.92
7 0.91
8 0.92
9 0.89
10 0.9
11 0.89
12 0.88
13 0.84
14 0.81
15 0.78
16 0.7
17 0.65
18 0.62
19 0.57
20 0.52
21 0.5
22 0.51
23 0.45
24 0.46
25 0.43
26 0.39
27 0.35
28 0.3
29 0.3
30 0.21
31 0.2
32 0.18
33 0.17
34 0.16
35 0.16
36 0.16
37 0.13
38 0.18
39 0.19
40 0.21
41 0.24
42 0.27
43 0.27
44 0.28
45 0.27
46 0.23
47 0.23
48 0.2
49 0.18
50 0.14
51 0.14
52 0.14
53 0.14
54 0.13
55 0.11
56 0.12
57 0.11
58 0.11
59 0.11
60 0.12
61 0.12
62 0.12
63 0.15
64 0.15
65 0.14
66 0.14
67 0.18
68 0.25
69 0.32
70 0.35
71 0.36
72 0.35
73 0.36
74 0.36
75 0.33
76 0.27
77 0.2
78 0.17
79 0.13
80 0.12
81 0.11
82 0.1
83 0.09
84 0.11
85 0.12
86 0.12
87 0.12
88 0.13
89 0.12
90 0.12
91 0.12
92 0.1
93 0.07
94 0.07
95 0.08
96 0.07
97 0.08
98 0.07
99 0.09
100 0.08
101 0.09
102 0.08
103 0.07
104 0.09
105 0.08
106 0.08
107 0.08
108 0.08
109 0.07
110 0.06
111 0.06
112 0.05
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.03
120 0.03
121 0.03
122 0.04
123 0.04
124 0.04
125 0.05
126 0.05
127 0.07
128 0.08
129 0.09
130 0.11
131 0.12
132 0.12
133 0.12
134 0.15
135 0.15
136 0.17
137 0.17
138 0.15
139 0.13
140 0.17
141 0.19
142 0.18
143 0.23
144 0.27
145 0.36
146 0.44
147 0.48
148 0.48
149 0.48
150 0.47
151 0.42
152 0.42
153 0.38
154 0.36
155 0.35
156 0.35
157 0.35
158 0.35
159 0.37
160 0.36
161 0.37
162 0.38
163 0.38
164 0.4
165 0.38
166 0.4
167 0.4
168 0.43
169 0.37
170 0.36
171 0.37
172 0.36
173 0.39
174 0.38
175 0.4
176 0.36
177 0.42
178 0.42
179 0.41
180 0.38
181 0.39
182 0.38
183 0.36
184 0.35
185 0.34
186 0.3
187 0.29
188 0.28
189 0.24
190 0.26
191 0.23
192 0.2
193 0.15
194 0.13
195 0.1
196 0.11
197 0.1
198 0.11
199 0.15
200 0.15
201 0.19
202 0.2
203 0.2
204 0.18
205 0.21
206 0.19
207 0.17
208 0.19
209 0.17
210 0.17
211 0.18
212 0.18
213 0.16
214 0.19
215 0.24
216 0.26
217 0.29
218 0.3
219 0.33
220 0.35
221 0.35
222 0.38
223 0.35
224 0.39
225 0.38
226 0.42
227 0.41
228 0.47
229 0.56
230 0.55
231 0.6
232 0.61
233 0.65
234 0.64
235 0.66
236 0.66
237 0.66