Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165M6U7

Protein Details
Accession A0A165M6U7    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-41PTSPRPQRKIACHFCRHRKLRCHydrophilic
61-90DEAHKKRGPDRFPGRRRKKAAEHKVGEDKABasic
NLS Segment(s)
PositionSequence
64-84HKKRGPDRFPGRRRKKAAEHK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR020448  Maltose_ferment_reg_DNA-bd  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSAPDDSAGTSKKASRSPSPTSPRPQRKIACHFCRHRKLRCDSARPVCGNCTRRSLPCSYDEAHKKRGPDRFPGRRRKKAAEHKVGEDKANTKTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.44
4 0.5
5 0.58
6 0.63
7 0.65
8 0.7
9 0.75
10 0.77
11 0.75
12 0.77
13 0.74
14 0.74
15 0.78
16 0.78
17 0.77
18 0.75
19 0.79
20 0.8
21 0.84
22 0.82
23 0.8
24 0.78
25 0.75
26 0.76
27 0.76
28 0.73
29 0.71
30 0.71
31 0.69
32 0.61
33 0.56
34 0.49
35 0.47
36 0.44
37 0.38
38 0.36
39 0.32
40 0.33
41 0.36
42 0.35
43 0.3
44 0.3
45 0.32
46 0.27
47 0.33
48 0.4
49 0.41
50 0.46
51 0.45
52 0.45
53 0.48
54 0.54
55 0.49
56 0.51
57 0.57
58 0.6
59 0.68
60 0.76
61 0.81
62 0.83
63 0.87
64 0.85
65 0.85
66 0.86
67 0.87
68 0.86
69 0.81
70 0.79
71 0.81
72 0.75
73 0.67
74 0.6
75 0.52