Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165MDD7

Protein Details
Accession A0A165MDD7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-75SQTPKVDKQEKKKTPKGRAKKRLLYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
40-66GKVKSQTPKVDKQEKKKTPKGRAKKRL
Subcellular Location(s) extr 8, mito 5, plas 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MAALSTLRRCFLDVTLVALLVLSSLVVWRAPVHGSLARAGKVKSQTPKVDKQEKKKTPKGRAKKRLLYNRRFVNVTLLPNGKRRMNANPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.2
4 0.18
5 0.16
6 0.15
7 0.08
8 0.07
9 0.03
10 0.02
11 0.02
12 0.03
13 0.03
14 0.04
15 0.04
16 0.06
17 0.06
18 0.07
19 0.1
20 0.11
21 0.12
22 0.15
23 0.17
24 0.17
25 0.18
26 0.18
27 0.19
28 0.2
29 0.24
30 0.26
31 0.3
32 0.35
33 0.39
34 0.47
35 0.51
36 0.58
37 0.6
38 0.65
39 0.7
40 0.73
41 0.77
42 0.78
43 0.8
44 0.8
45 0.85
46 0.86
47 0.86
48 0.88
49 0.88
50 0.89
51 0.89
52 0.9
53 0.89
54 0.87
55 0.85
56 0.82
57 0.76
58 0.69
59 0.59
60 0.56
61 0.5
62 0.45
63 0.41
64 0.38
65 0.37
66 0.41
67 0.46
68 0.41
69 0.4
70 0.41
71 0.44