Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165GB99

Protein Details
Accession A0A165GB99    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRKPQGPKKREAVETBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSRKPQGPKKR
Subcellular Location(s) mito 16, cyto_nucl 6, nucl 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPQGPKKREAVETVFTCLYCHHDKSVNCKIDRKEGLAYLQCKVCGQSFQGRVHHLTEPVDVYSMWVDAADEAEKTMPSTSSVRRPAAVADAGGDSDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.89
3 0.85
4 0.77
5 0.72
6 0.66
7 0.63
8 0.55
9 0.51
10 0.42
11 0.34
12 0.31
13 0.26
14 0.26
15 0.22
16 0.22
17 0.2
18 0.26
19 0.27
20 0.36
21 0.45
22 0.46
23 0.44
24 0.48
25 0.48
26 0.51
27 0.51
28 0.46
29 0.38
30 0.32
31 0.34
32 0.33
33 0.32
34 0.25
35 0.24
36 0.21
37 0.19
38 0.18
39 0.15
40 0.11
41 0.12
42 0.17
43 0.21
44 0.25
45 0.27
46 0.28
47 0.29
48 0.31
49 0.3
50 0.24
51 0.2
52 0.17
53 0.16
54 0.14
55 0.13
56 0.1
57 0.1
58 0.09
59 0.08
60 0.06
61 0.05
62 0.05
63 0.04
64 0.06
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.07
71 0.08
72 0.07
73 0.1
74 0.14
75 0.19
76 0.27
77 0.33
78 0.35
79 0.35
80 0.35
81 0.34
82 0.34
83 0.31
84 0.22
85 0.18
86 0.16
87 0.16