Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165BVL3

Protein Details
Accession A0A165BVL3   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-60MFRFCSSKCHKNFKMKRNPRKVKWTKAFRKAAGHydrophilic
NLS Segment(s)
PositionSequence
41-59KMKRNPRKVKWTKAFRKAA
Subcellular Location(s) mito 14.5, mito_nucl 11.666, nucl 7.5, cyto_nucl 7.333, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR011017  TRASH_dom  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRVEKCYFCSKPCYPGHGIAFVRNDAKMFRFCSSKCHKNFKMKRNPRKVKWTKAFRKAAGKEMNIDATYEFEKRRNVPVRYDRELMQTTVKAMQRVAEIRKRREHAFWKNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.52
4 0.51
5 0.49
6 0.44
7 0.42
8 0.38
9 0.35
10 0.28
11 0.25
12 0.19
13 0.21
14 0.19
15 0.2
16 0.2
17 0.24
18 0.24
19 0.32
20 0.4
21 0.46
22 0.49
23 0.56
24 0.61
25 0.67
26 0.77
27 0.78
28 0.81
29 0.82
30 0.86
31 0.88
32 0.91
33 0.86
34 0.88
35 0.86
36 0.85
37 0.84
38 0.85
39 0.82
40 0.82
41 0.82
42 0.74
43 0.75
44 0.66
45 0.64
46 0.59
47 0.5
48 0.42
49 0.37
50 0.36
51 0.26
52 0.24
53 0.16
54 0.12
55 0.13
56 0.12
57 0.12
58 0.13
59 0.17
60 0.18
61 0.28
62 0.35
63 0.36
64 0.44
65 0.52
66 0.57
67 0.6
68 0.6
69 0.52
70 0.49
71 0.49
72 0.41
73 0.36
74 0.28
75 0.24
76 0.28
77 0.29
78 0.24
79 0.22
80 0.22
81 0.23
82 0.28
83 0.34
84 0.37
85 0.44
86 0.5
87 0.6
88 0.62
89 0.62
90 0.66
91 0.69