Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165E0X5

Protein Details
Accession A0A165E0X5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-34NAPARSFCSRPLRHRRRRRARCTPTSWNARVHydrophilic
NLS Segment(s)
PositionSequence
16-23RHRRRRRA
Subcellular Location(s) mito 14.5, mito_nucl 13, nucl 10.5
Family & Domain DBs
Amino Acid Sequences LSLNAPARSFCSRPLRHRRRRRARCTPTSWNARVEARRRCRSWNAWLEASGYRRYPWLEARHAWLVNTGNDDGSGLYFVTCSFGPALIRRCIDGSSQLVSRLCPHRSYHTVPENIVPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.71
3 0.77
4 0.87
5 0.91
6 0.91
7 0.95
8 0.95
9 0.95
10 0.94
11 0.94
12 0.91
13 0.89
14 0.87
15 0.85
16 0.77
17 0.69
18 0.61
19 0.57
20 0.55
21 0.53
22 0.54
23 0.54
24 0.6
25 0.59
26 0.62
27 0.63
28 0.62
29 0.64
30 0.63
31 0.58
32 0.51
33 0.49
34 0.46
35 0.41
36 0.38
37 0.3
38 0.21
39 0.16
40 0.16
41 0.17
42 0.16
43 0.19
44 0.22
45 0.24
46 0.25
47 0.29
48 0.31
49 0.3
50 0.28
51 0.25
52 0.21
53 0.18
54 0.19
55 0.15
56 0.11
57 0.11
58 0.11
59 0.08
60 0.07
61 0.06
62 0.04
63 0.04
64 0.04
65 0.04
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.09
72 0.13
73 0.18
74 0.21
75 0.21
76 0.22
77 0.22
78 0.22
79 0.22
80 0.22
81 0.21
82 0.2
83 0.2
84 0.22
85 0.22
86 0.22
87 0.27
88 0.29
89 0.29
90 0.29
91 0.32
92 0.37
93 0.44
94 0.5
95 0.53
96 0.56
97 0.57
98 0.54