Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165CER0

Protein Details
Accession A0A165CER0    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
274-306KTAVVRAAKRHQREINCRKNKKIETLQNERQAAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.5, nucl 10, cyto 9, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF03372  Exo_endo_phos  
Amino Acid Sequences MQEIETIYKDLHVVNSSHPDNPTGAGGVALIFNKRLTNTTTLDTHVLVPGRAILTTMNWHRNDELTFLAIYGPNDRLENREMWEQIETKIRDAGGTLPKPDVMLGDFNFVEDAIDRFPAKTNDSDAPPTFDSLKRYLCPPKDRNVPDNLRVTDGWRETFPATTEYTWRDASRSKLSRIDRIYMTRSLNLASRNWDIQLTDLNKNDHSRVSVEIVNLDAPYVGPGRWTMRENLLDDEEFLEAVDIAGKHAMNEIALLGADRTDERNVQTIYRDFKTAVVRAAKRHQREINCRKNKKIETLQNERQAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.28
3 0.29
4 0.32
5 0.31
6 0.3
7 0.28
8 0.28
9 0.25
10 0.17
11 0.15
12 0.12
13 0.11
14 0.1
15 0.1
16 0.1
17 0.09
18 0.09
19 0.1
20 0.11
21 0.12
22 0.14
23 0.16
24 0.2
25 0.23
26 0.25
27 0.26
28 0.28
29 0.28
30 0.27
31 0.24
32 0.23
33 0.21
34 0.17
35 0.15
36 0.15
37 0.13
38 0.12
39 0.11
40 0.09
41 0.09
42 0.16
43 0.22
44 0.28
45 0.28
46 0.3
47 0.31
48 0.33
49 0.32
50 0.28
51 0.23
52 0.16
53 0.15
54 0.14
55 0.14
56 0.12
57 0.12
58 0.12
59 0.13
60 0.12
61 0.13
62 0.14
63 0.16
64 0.17
65 0.19
66 0.19
67 0.23
68 0.22
69 0.22
70 0.25
71 0.22
72 0.22
73 0.28
74 0.26
75 0.22
76 0.23
77 0.22
78 0.19
79 0.18
80 0.22
81 0.23
82 0.24
83 0.24
84 0.23
85 0.23
86 0.23
87 0.22
88 0.17
89 0.1
90 0.11
91 0.11
92 0.13
93 0.13
94 0.12
95 0.12
96 0.11
97 0.1
98 0.07
99 0.07
100 0.05
101 0.07
102 0.07
103 0.07
104 0.1
105 0.12
106 0.13
107 0.14
108 0.17
109 0.19
110 0.21
111 0.24
112 0.22
113 0.24
114 0.23
115 0.23
116 0.21
117 0.2
118 0.21
119 0.21
120 0.23
121 0.19
122 0.24
123 0.3
124 0.34
125 0.41
126 0.41
127 0.46
128 0.53
129 0.56
130 0.55
131 0.57
132 0.55
133 0.51
134 0.54
135 0.46
136 0.39
137 0.35
138 0.33
139 0.29
140 0.25
141 0.21
142 0.15
143 0.16
144 0.14
145 0.15
146 0.14
147 0.12
148 0.12
149 0.12
150 0.14
151 0.14
152 0.16
153 0.17
154 0.16
155 0.16
156 0.17
157 0.21
158 0.28
159 0.3
160 0.3
161 0.36
162 0.39
163 0.44
164 0.44
165 0.44
166 0.37
167 0.37
168 0.38
169 0.35
170 0.34
171 0.28
172 0.26
173 0.23
174 0.23
175 0.21
176 0.19
177 0.18
178 0.19
179 0.18
180 0.18
181 0.18
182 0.15
183 0.14
184 0.19
185 0.19
186 0.21
187 0.23
188 0.24
189 0.26
190 0.28
191 0.28
192 0.23
193 0.2
194 0.18
195 0.17
196 0.19
197 0.18
198 0.17
199 0.16
200 0.16
201 0.15
202 0.13
203 0.11
204 0.08
205 0.05
206 0.07
207 0.07
208 0.06
209 0.06
210 0.08
211 0.12
212 0.15
213 0.17
214 0.18
215 0.23
216 0.27
217 0.28
218 0.3
219 0.29
220 0.26
221 0.25
222 0.23
223 0.17
224 0.13
225 0.11
226 0.08
227 0.05
228 0.05
229 0.07
230 0.06
231 0.06
232 0.08
233 0.08
234 0.08
235 0.1
236 0.1
237 0.08
238 0.08
239 0.07
240 0.06
241 0.06
242 0.06
243 0.05
244 0.04
245 0.05
246 0.06
247 0.08
248 0.1
249 0.13
250 0.14
251 0.21
252 0.22
253 0.23
254 0.27
255 0.3
256 0.34
257 0.34
258 0.34
259 0.28
260 0.32
261 0.37
262 0.34
263 0.36
264 0.39
265 0.4
266 0.45
267 0.55
268 0.59
269 0.58
270 0.65
271 0.67
272 0.68
273 0.76
274 0.81
275 0.82
276 0.84
277 0.86
278 0.85
279 0.88
280 0.84
281 0.84
282 0.83
283 0.82
284 0.81
285 0.84
286 0.84