Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166NAF1

Protein Details
Accession A0A166NAF1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
86-111KILEHKEKEREREKKRTRRCVFIYMGBasic
NLS Segment(s)
PositionSequence
86-103KILEHKEKEREREKKRTR
Subcellular Location(s) mito 19, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039715  ZCCHC10  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF13917  zf-CCHC_3  
Amino Acid Sequences MSKFAPHRRGTNAPRATSSTVCQKCLGTGHFTYECKGSRPYISRPSRTEQLEKPKLAEKMREKLAIAGPGPAPGSSSAAAKGTADKILEHKEKEREREKKRTRRCVFIYMGCAFTRRTWN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.55
4 0.47
5 0.43
6 0.43
7 0.38
8 0.38
9 0.36
10 0.32
11 0.29
12 0.31
13 0.3
14 0.25
15 0.23
16 0.26
17 0.29
18 0.29
19 0.28
20 0.28
21 0.27
22 0.24
23 0.26
24 0.22
25 0.24
26 0.28
27 0.34
28 0.4
29 0.46
30 0.5
31 0.51
32 0.55
33 0.55
34 0.54
35 0.53
36 0.49
37 0.53
38 0.53
39 0.5
40 0.46
41 0.44
42 0.45
43 0.42
44 0.43
45 0.37
46 0.37
47 0.39
48 0.39
49 0.34
50 0.32
51 0.33
52 0.27
53 0.22
54 0.18
55 0.15
56 0.14
57 0.14
58 0.11
59 0.1
60 0.08
61 0.1
62 0.08
63 0.09
64 0.09
65 0.09
66 0.1
67 0.09
68 0.1
69 0.09
70 0.11
71 0.1
72 0.1
73 0.13
74 0.21
75 0.25
76 0.26
77 0.31
78 0.38
79 0.44
80 0.52
81 0.59
82 0.61
83 0.66
84 0.74
85 0.8
86 0.81
87 0.87
88 0.89
89 0.85
90 0.85
91 0.83
92 0.8
93 0.76
94 0.71
95 0.67
96 0.58
97 0.55
98 0.45
99 0.41
100 0.33