Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166AH40

Protein Details
Accession A0A166AH40    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
50-71LSRPNHRSKPHRLTTRRRPGPIBasic
NLS Segment(s)
PositionSequence
33-100PRHIPLEVPSKLHRNRGLSRPNHRSKPHRLTTRRRPGPIQTPPGSALRSADRRPRVGHPTVRNRAREL
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MQSFPGSHCNGVSKIARSDPVRTPGTARGFRGPRHIPLEVPSKLHRNRGLSRPNHRSKPHRLTTRRRPGPIQTPPGSALRSADRRPRVGHPTVRNRARELR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.34
4 0.33
5 0.37
6 0.38
7 0.41
8 0.39
9 0.36
10 0.37
11 0.38
12 0.44
13 0.43
14 0.39
15 0.41
16 0.42
17 0.43
18 0.48
19 0.44
20 0.41
21 0.42
22 0.4
23 0.33
24 0.33
25 0.39
26 0.32
27 0.32
28 0.29
29 0.32
30 0.34
31 0.39
32 0.39
33 0.37
34 0.41
35 0.46
36 0.52
37 0.51
38 0.58
39 0.62
40 0.65
41 0.67
42 0.68
43 0.67
44 0.68
45 0.71
46 0.71
47 0.72
48 0.73
49 0.76
50 0.81
51 0.85
52 0.83
53 0.76
54 0.72
55 0.68
56 0.7
57 0.68
58 0.66
59 0.57
60 0.52
61 0.51
62 0.49
63 0.43
64 0.33
65 0.27
66 0.26
67 0.29
68 0.31
69 0.38
70 0.41
71 0.44
72 0.48
73 0.53
74 0.53
75 0.56
76 0.6
77 0.62
78 0.67
79 0.74
80 0.78
81 0.74