Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165D7E2

Protein Details
Accession A0A165D7E2    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-79DPPPKVKREPKVKLEPKEAKKPLKRVTRSSKRQKTASBasic
NLS Segment(s)
PositionSequence
46-76PKVKREPKVKLEPKEAKKPLKRVTRSSKRQK
Subcellular Location(s) cyto 13, cyto_nucl 10.333, cyto_mito 10.333, nucl 6.5, mito 6.5
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MSERAICRYPPLGSAGGALVGSGSSCAVTDSEEEDDAEVVIVDPPPKVKREPKVKLEPKEAKKPLKRVTRSSKRQKTASPAPDREVTDLTVEDTGETMSVEEARELYRFNNAQVLQDMAVEDDERGYTGHPALAGPSNASASASVSVGAGPSTSGASTSVLPTTASSDLRWETPEPDEGSAIPTRWSLGIPPPPPPAKKFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.19
3 0.16
4 0.14
5 0.12
6 0.07
7 0.06
8 0.05
9 0.04
10 0.04
11 0.03
12 0.04
13 0.05
14 0.05
15 0.06
16 0.07
17 0.09
18 0.11
19 0.12
20 0.12
21 0.12
22 0.12
23 0.11
24 0.09
25 0.07
26 0.05
27 0.06
28 0.07
29 0.07
30 0.07
31 0.11
32 0.13
33 0.16
34 0.22
35 0.29
36 0.38
37 0.48
38 0.56
39 0.62
40 0.71
41 0.77
42 0.78
43 0.81
44 0.81
45 0.77
46 0.79
47 0.78
48 0.76
49 0.74
50 0.77
51 0.75
52 0.75
53 0.74
54 0.73
55 0.76
56 0.78
57 0.81
58 0.83
59 0.84
60 0.8
61 0.79
62 0.74
63 0.71
64 0.7
65 0.69
66 0.67
67 0.6
68 0.56
69 0.56
70 0.53
71 0.46
72 0.37
73 0.28
74 0.2
75 0.17
76 0.15
77 0.11
78 0.09
79 0.07
80 0.06
81 0.05
82 0.04
83 0.04
84 0.03
85 0.03
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.06
93 0.06
94 0.1
95 0.11
96 0.11
97 0.16
98 0.16
99 0.16
100 0.16
101 0.17
102 0.13
103 0.12
104 0.12
105 0.07
106 0.07
107 0.06
108 0.05
109 0.04
110 0.04
111 0.04
112 0.05
113 0.05
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.07
120 0.1
121 0.09
122 0.09
123 0.09
124 0.09
125 0.09
126 0.09
127 0.08
128 0.07
129 0.07
130 0.07
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.05
137 0.04
138 0.04
139 0.05
140 0.04
141 0.05
142 0.06
143 0.07
144 0.08
145 0.09
146 0.09
147 0.09
148 0.09
149 0.09
150 0.12
151 0.13
152 0.14
153 0.13
154 0.16
155 0.17
156 0.18
157 0.21
158 0.19
159 0.19
160 0.21
161 0.26
162 0.24
163 0.24
164 0.24
165 0.21
166 0.23
167 0.23
168 0.21
169 0.17
170 0.15
171 0.15
172 0.15
173 0.15
174 0.14
175 0.2
176 0.28
177 0.29
178 0.35
179 0.41
180 0.48
181 0.52