Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165PGF8

Protein Details
Accession A0A165PGF8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-46AASIPIVKKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
9-52KKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQLPMPK
Subcellular Location(s) mito 12.5, mito_nucl 12.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASIPIVKKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLLPNGLKKLVVYNLRELDLLLMHNKSYAAEIAHSVSSRNRIEILARARALGVKVTNPAARLRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.82
3 0.89
4 0.91
5 0.9
6 0.9
7 0.88
8 0.86
9 0.83
10 0.76
11 0.66
12 0.62
13 0.6
14 0.59
15 0.61
16 0.61
17 0.59
18 0.57
19 0.58
20 0.61
21 0.63
22 0.64
23 0.64
24 0.66
25 0.71
26 0.78
27 0.83
28 0.76
29 0.73
30 0.71
31 0.67
32 0.67
33 0.64
34 0.64
35 0.63
36 0.65
37 0.59
38 0.52
39 0.46
40 0.37
41 0.37
42 0.33
43 0.35
44 0.4
45 0.41
46 0.42
47 0.45
48 0.47
49 0.47
50 0.45
51 0.47
52 0.45
53 0.53
54 0.55
55 0.51
56 0.47
57 0.39
58 0.36
59 0.32
60 0.29
61 0.2
62 0.22
63 0.23
64 0.24
65 0.24
66 0.22
67 0.18
68 0.13
69 0.12
70 0.1
71 0.09
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.09
78 0.07
79 0.08
80 0.09
81 0.1
82 0.11
83 0.11
84 0.12
85 0.13
86 0.19
87 0.19
88 0.19
89 0.18
90 0.18
91 0.2
92 0.26
93 0.3
94 0.3
95 0.29
96 0.28
97 0.28
98 0.29
99 0.28
100 0.24
101 0.21
102 0.16
103 0.19
104 0.23
105 0.24
106 0.24
107 0.27
108 0.27