Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165PYF5

Protein Details
Accession A0A165PYF5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
358-377PTPQPTPSSCSKKMRSRSRQHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR006710  Glyco_hydro_43  
IPR016840  Glyco_hydro_43_endo_a_Ara-ase  
IPR023296  Glyco_hydro_beta-prop_sf  
Gene Ontology GO:0046558  F:arabinan endo-1,5-alpha-L-arabinosidase activity  
GO:0031222  P:arabinan catabolic process  
Pfam View protein in Pfam  
PF04616  Glyco_hydro_43  
CDD cd18831  GH43_AnAbnA-like  
Amino Acid Sequences MKLSFQFGLLLAQSLLAFTVAAYPNPIPGSDNIEVRDPAIYYNPDTKKYFVFSTHEGVKIFQSKSITGPWERTGSALPGKCSVIDLPGRCETWAPDIALVNGTYTLYYSVSAIGSADSAIGVAQSPTMEEGSWTDLGEVIRSGPGLNYNCIDPNLIDDGGLKLTFGSYWDGMFQIPMNDVKTPAEQLPGVHLAGNGGRPAEGGFVYKSPDSPHYFMFFSDGITPLLGAQDHPPAGKEYKVLVGRGESPTGPFFGKLGNVLTDKMDPPTGSLVLGSHDNVYAPGGQSLFRDPVSGRDVISYHYVKLSDPIGGPSYLGINYLDFSSGWPEVVDLEPVQPAPEEPAPTPTPEPAPEPTFVPTPQPTPSSCSKKMRSRSRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.07
4 0.06
5 0.05
6 0.11
7 0.12
8 0.12
9 0.15
10 0.15
11 0.18
12 0.19
13 0.2
14 0.15
15 0.16
16 0.24
17 0.24
18 0.26
19 0.25
20 0.28
21 0.27
22 0.26
23 0.26
24 0.18
25 0.16
26 0.18
27 0.19
28 0.19
29 0.29
30 0.32
31 0.36
32 0.38
33 0.39
34 0.37
35 0.39
36 0.38
37 0.33
38 0.35
39 0.33
40 0.37
41 0.4
42 0.39
43 0.36
44 0.34
45 0.34
46 0.35
47 0.32
48 0.29
49 0.27
50 0.25
51 0.27
52 0.3
53 0.31
54 0.26
55 0.3
56 0.3
57 0.31
58 0.3
59 0.29
60 0.26
61 0.25
62 0.29
63 0.28
64 0.26
65 0.26
66 0.26
67 0.25
68 0.25
69 0.21
70 0.19
71 0.22
72 0.21
73 0.24
74 0.27
75 0.27
76 0.26
77 0.26
78 0.23
79 0.22
80 0.24
81 0.2
82 0.18
83 0.18
84 0.19
85 0.19
86 0.18
87 0.13
88 0.1
89 0.09
90 0.07
91 0.07
92 0.07
93 0.06
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.06
101 0.05
102 0.05
103 0.05
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.04
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.09
119 0.1
120 0.1
121 0.09
122 0.1
123 0.11
124 0.11
125 0.1
126 0.07
127 0.07
128 0.07
129 0.07
130 0.05
131 0.11
132 0.12
133 0.13
134 0.13
135 0.14
136 0.14
137 0.15
138 0.15
139 0.09
140 0.1
141 0.11
142 0.11
143 0.1
144 0.09
145 0.1
146 0.1
147 0.1
148 0.07
149 0.05
150 0.05
151 0.05
152 0.05
153 0.07
154 0.06
155 0.06
156 0.07
157 0.07
158 0.07
159 0.08
160 0.07
161 0.05
162 0.06
163 0.07
164 0.08
165 0.08
166 0.09
167 0.09
168 0.1
169 0.11
170 0.1
171 0.1
172 0.1
173 0.09
174 0.11
175 0.12
176 0.11
177 0.1
178 0.09
179 0.08
180 0.09
181 0.09
182 0.07
183 0.05
184 0.05
185 0.05
186 0.05
187 0.06
188 0.05
189 0.06
190 0.06
191 0.07
192 0.09
193 0.09
194 0.09
195 0.1
196 0.15
197 0.18
198 0.19
199 0.2
200 0.21
201 0.22
202 0.21
203 0.22
204 0.17
205 0.14
206 0.13
207 0.13
208 0.1
209 0.1
210 0.09
211 0.07
212 0.07
213 0.06
214 0.06
215 0.06
216 0.08
217 0.09
218 0.09
219 0.1
220 0.12
221 0.13
222 0.13
223 0.13
224 0.12
225 0.18
226 0.2
227 0.19
228 0.17
229 0.18
230 0.21
231 0.21
232 0.21
233 0.15
234 0.15
235 0.15
236 0.16
237 0.15
238 0.11
239 0.1
240 0.1
241 0.1
242 0.1
243 0.1
244 0.11
245 0.12
246 0.12
247 0.13
248 0.14
249 0.14
250 0.15
251 0.15
252 0.12
253 0.13
254 0.14
255 0.13
256 0.11
257 0.11
258 0.1
259 0.1
260 0.11
261 0.1
262 0.08
263 0.08
264 0.08
265 0.08
266 0.09
267 0.09
268 0.08
269 0.09
270 0.09
271 0.09
272 0.1
273 0.13
274 0.14
275 0.13
276 0.14
277 0.13
278 0.18
279 0.21
280 0.2
281 0.18
282 0.18
283 0.18
284 0.19
285 0.25
286 0.21
287 0.18
288 0.19
289 0.2
290 0.17
291 0.2
292 0.19
293 0.15
294 0.15
295 0.17
296 0.17
297 0.16
298 0.16
299 0.14
300 0.15
301 0.12
302 0.12
303 0.1
304 0.08
305 0.09
306 0.09
307 0.09
308 0.08
309 0.08
310 0.12
311 0.11
312 0.11
313 0.1
314 0.1
315 0.11
316 0.12
317 0.13
318 0.1
319 0.11
320 0.12
321 0.12
322 0.12
323 0.11
324 0.1
325 0.14
326 0.16
327 0.18
328 0.18
329 0.25
330 0.26
331 0.29
332 0.31
333 0.28
334 0.29
335 0.28
336 0.31
337 0.3
338 0.32
339 0.3
340 0.3
341 0.3
342 0.3
343 0.29
344 0.31
345 0.29
346 0.29
347 0.32
348 0.33
349 0.31
350 0.34
351 0.43
352 0.46
353 0.51
354 0.58
355 0.63
356 0.69
357 0.78